2mymoviz.pw Website Review


Make info private

Traffic and Value

Is 2mymoviz.pw legit?
Website Value $309
Alexa Rank 1365531
Monthly Visits 3432
Daily Visits 115
Monthly Earnings $17.16
Daily Earnings $0.57
Click Here for Full Review

2mymoviz.pw Server Location

Country: United States
Metropolitan Area: Not defined
Postal Reference Code: Not defined
Latitude: 37.751
Longitude: -97.822




Summarized Content

MY MOVEZ MYMOVIZ Do*nload movies and serials with direct link Registration date Release Points Number of votes Users Number of votes IMDB Cost of generating sales Total Visits 9 above 8.5 over 8 over 7.5 over 7 over 6 over 5 under 5 all over 9 over 8.5 over 8 over 7.5 over 7 top 6 over 5 under 5 all above 90 above 80 above 70 over 60 over 50 under 50 All suitable for all ages over the age of 13 over the age of 17 years All BDRipBluRay 1080pBluRay 1080p 3DBluRay 1080p Full HDBluRay 1080p Full HD 3DBluRay 1080p mHDBluRay 1080p x265BluRay 21 60p 4KBluRay 480pBluRay 720pBluRay 720p 3DBluRay 720p HDBluRay 720p mHDBluRay 720p x264BluRay 720p x265CAMDVDRipDVDRip 720pDVDScrDVDScr 720pHDCAMHDCAM 720pHDRipHDRip 1080pHDRip 720pHDTSHDTS 720pHDTVHDTV 1080pHDTV 480pHDTV 720pHDTV 720p x265TSTS 720pTVRipVHSRipWEB-DLWEB-DL 1080pWEB-DL 1080p HQWEB-DL 2160p 4KWEB-DL 480pWEB-DL 720pWEB-DL 720p x265WEBRipWEBRip Rico Zrbayjanarzhantynafryqay SouthAllianceGermanyGermanyGermanyGermanyAmericaAustraliaAustraliaAustraliaSlovakiaSpanishAustraliaSwedenAustraliaSlovakidSwedenAustraliaGermanyAustraliaUnitedGenlandIrelandIrelandIslandBahmabrzylBrusselsBulgariaBulgariaSwedenSwedenSwedenSwedenSwedenSwedenSwedenSwitzerlandPaperStonePaperlandPerwiesZone Ndtayvantrkyhtvnsjmhvry shop Chkjmhvry Mqdvnyhchkslvakychyndanmarkrvsyhrvmanyzymbavhzhapnsrylankasngapvrsvydsvyyssvdansvryhsvmalyshylysrbstanrbstan


2mymoviz Main Page Content

HTML Tag Content Informative?
Title: MY MOVEEZ MyMoviz Could be improved
Description: MyMoviz The most comprehensive site for movies and serials with Persian dubbing and omitted, 2018 movies, 2017, direct link
H1: Direct MyMoviz and serial direct link Is it informative enough?
H2: Captain Morten and the Spider Queen (2018) Is it informative enough?
H3: with dubbed version of Persian omitted (bilingual)

Other Helpful Websites and Services for 2mymoviz

Internal Pages

/?orderBy=7&pageSizeLimit=50&pageId=2:
Title

MY MOVEEZ MyMoviz

Description

MY MOVEEZ | ZDESCRZ MY MOVEEE MyMoviz The most comprehensive site for movies and serials with Persian dubbing, and omitted, 2018 movie , 2017 movie ,

[censored]

H3

direct link Drama

[censored]

/?orderBy=8&pageSizeLimit=200&pageId=3:
Description

Not defined

H3

along with the Persian version of the dubbing and omitted (bilingual)

[censored]

/?from=2018&to=2018&oB=3&minVotes=2000:
Title

MY MOVEIZ MyMoviz movie and serial direct link

[censored]

Description

MyMoviz The most comprehensive site for ing movies and serials with Persian dubbing and and omitted, ing 2018 movies, ing 2017, ing direct link

[censored]

H3

along with the Persian version of the dubbing and omitted (bilingual)

[censored]

All the information about 2mymoviz.pw was collected from publicly available sources

Similar domain names

2mymunciedentalcare.com2mynameins3344.net2myndzalyke.info2mymoscow.com2mymom.com2mymihanmusic.com



CAPTCHA ERROR
Recent Comments
Ronald Kurtz about trimbodymax.com
You took 89.95 and 84.95 at the same time from my back account that i didnt authorize and was apparently hacked. I...
Ester Joseph about repassists.com
Please refund my money back I never knew this am not interested
Jose Chavez about spoosk.com
Ive been charged for no reason this is fraud and want my money back!
CHANTREA BO about sitetaskreps.com
Good morning, Can you tell me what i have been charged for on 10/8/19 amount of $61..90 I believe this could be...
Leo Wickers IV about dotabon.com
Stop charging my account or police and better business bureau will be notified
tangi muzzo about attrdte.com
I need the money tht you took from my account.. I have no idea of what this site is all about.. Please return my...
Mthetheleli Peter about feemyd.com
This is a fraud I want my money back
motonobu matsubara about talentbrainstore.com
Please refund my 100yen and 10,000yen you took fraudulently as I never purchased or joined your site. Please cancel...
Selwyn Clarke about cartplay.com
Hi I sent an e-mail to you Thursday (nz) time and as yet I have had no response the number referred to is...
Nicolash Fernandes about ddos-guard.net
Knowing how reliable and secure DDoS protection service from ddos-guard.net, I have updated my plan with them and...
John about webtermdata.com
You have charged my credit card for $54.56 please add it back and cancel my subscription card ending 6485
DMCA.com Protection Status