Directenergyprotects.com receives about 2772 visitors in one month. That could possibly earn $13.86 each month or $0.46 each day. Server of the website is located in the United States. Directenergyprotects.com main page was reached and loaded in 1.91 seconds. This is a good result. Try the services listed at the bottom of the page to search for available improvements.
Traffic and Value
| Is directenergyprotects.com legit? | |
| Website Value | $250 |
| Alexa Rank | 1688216 |
| Monthly Visits | 2772 |
| Daily Visits | 93 |
| Monthly Earnings | $13.86 |
| Daily Earnings | $0.46 |
Directenergyprotects.com Server Location
Country: United States
Metropolitan Area: Not defined
Postal Reference Code: Not defined
Latitude: 37.751
Longitude: -97.822
Summarized Content
Directenergyprotects Main Page Content
| HTML Tag | Content | Informative? |
|---|---|---|
| Title: | Home Protection Plans | Direct Energy Protection | Could be improved |
| Description: | Sign up for a home protection plan from Direct Energy and protect your home against the unexpected. We cover home maintenance, repair, and |  |
| H1: | Home Protection Plans for the Unexpected. | Is it informative enough? |
| H2: | Customize Your Coverage | Is it informative enough? |
| H3: | Maintenance Plans | Is it informative enough? |
We've noticed that you have issues with some content elements on the main page:
• Title contains 53 characters. We think that you could improve this tag by adding more relevant information or keywords.
• Take a look at the headings; there might be too little information. Headings are important for usability and search engine optimization.
Other Helpful Websites and Services for Directenergyprotects
Results will appear here |
|
Pingdom - Web transfer-speed test from Pingdom
Run diagnostic transfer-rate tests on each page or individual page components (JS, .img, and HTML code) with Pingdom for directenergyprotects.com
Google’s Web Analytics Google provides many analytical tools for the web that will help you find out the number of visitors, their locations and activities when logging onto directenergyprotects.com
Alexa - directenergyprotects.com on Alexa Traffic Rank Data
Alexa provides a charting service that shows global position by audience, engagement, and time spent on directenergyprotects.com
Majestic Backlinks - Lookup other webpages that have hyperlinks leading to directenergyprotects.com.
Google Index - Which of the pages is Google.com indexing?
Find out which pages from directenergyprotects.com have made it into Google.com’s listings. You can find out with the "site:" query.
Website on this IP by Bing - All sites on the same 107.162.147.25 IP
View a list of websites with an IP matching that of directenergyprotects.com from Bing.com
Internal Pages
| /protection-plans: | |
|---|---|
| Title |
Home Protection Plans | Direct Energy Protection Plan |
| Description |
Protect Your Home with a Protection Plan from Direct Energy. We cover repair and maintenance for heating and air conditioning, plumbing, electrical, and more. Call us today for a customized protection plan quote. |
| H1 |
Live Worry-Free with a Home Protection Plan |
| H2 |
Customize Your Coverage |
| H3 |
Direct Energy® can help! |
| /protection-plans/maintenance-plans: | |
|---|---|
| Title |
Home Maintenance Protection & Service Plan | Direct Energy Home Protection Plan |
| Description |
Gain peace of mind with a Direct Energy Protection Plans home maintenance protection plan for your home. Enroll today have one less thing to worry about. |
| H1 |
Home Maintenance Protection Plans |
| H2 |
Take care of the parts of your home you need most |
| H3 |
Home maintenance made simple |
| /protection-plans/repair-plans: | |
|---|---|
| Title |
Home Repair & Service Protection Plans | Direct Energy Protection Plan |
| Description |
Worried about the high cost of home repair when something breaks? Gain peace of mind with a Direct Energy home repair protection plan. Enroll today have one less thing to worry about. |
| H1 |
Home Repair Protection Plans |
| H2 |
Options for every home |
| H3 |
Protect your budget from unexpected expenses |
| /protection-plans/maintenance-and-repair-plans: | |
|---|---|
| Title |
Home Maintenance & Emergency Repair Service Plans | Direct Energy Protection Plan |
| Description |
Direct Energy Protection Plans offer plans to repair and maintain everything from your electrical, plumbing, and HVAC systems, to your sensitive electronics and appliances. |
| H1 |
Home Maintenance & Repair Plans |
| H2 |
Protect the critical systems in your home. |
| H3 |
Complete protection for all the essential systems in your home |
| /meet-direct-energy: | |
|---|---|
| Title |
Meet Direct Energy | Direct Energy Protection Plan |
| Description |
Direct Energy uses our energy expertise to make a difference in the lives of our customers. |
| H1 |
We Use Our Energy Expertise To Make A Difference In Your Life |
| H2 |
Direct Energy Protection Plans |
| H3 |
Helping You Care for Your Home |
Similar domain names
directenergyregulatedservice.comdirectenergyregulatedservices.comdirectenergysaving.windirectenergyprojects.comdirectenergyproducts.comdirectenergymn.com
Good morning, Can you tell me what i have been charged for on 10/8/19 amount of $61..90 I believe this could be...
Stop charging my account or police and better business bureau will be notified
I need the money tht you took from my account.. I have no idea of what this site is all about.. Please return my...
Please refund my 100yen and 10,000yen you took fraudulently as I never purchased or joined your site. Please cancel...
Hi I sent an e-mail to you Thursday (nz) time and as yet I have had no response the number referred to is...
Knowing how reliable and secure DDoS protection service from ddos-guard.net, I have updated my plan with them and...
You have charged my credit card for $54.56 please add it back and cancel my subscription card ending 6485
You took 89.95 and 84.95 at the same time from my back account that i didnt authorize and was apparently hacked. I...