Effectpay.net receives about 134 visitors in one month. That could possibly earn $0.67 each month or $0.02 each day. Server of the website is located in Germany. Effectpay.net main page was reached and loaded in 1.14 seconds. This is a good result. Try the services listed at the bottom of the page to search for available improvements.
Is effectpay.net legit? | |
Website Value | $13 |
Alexa Rank | 26815478 |
Monthly Visits | 134 |
Daily Visits | 5 |
Monthly Earnings | $0.67 |
Daily Earnings | $0.02 |
Country: Germany
Metropolitan Area: Frankfurt am Main
Postal Reference Code: 60313
Latitude: 50.1188
Longitude: 8.6843
Results will appear here |
|
Pingdom - Web transfer-speed test from Pingdom
Run diagnostic transfer-rate tests on each page or individual page components (JS, .img, and HTML code) with Pingdom for effectpay.net
Google’s Web Analytics Google provides many analytical tools for the web that will help you find out the number of visitors, their locations and activities when logging onto effectpay.net
Alexa - effectpay.net on Alexa Traffic Rank Data
Alexa provides a charting service that shows global position by audience, engagement, and time spent on effectpay.net
Majestic Backlinks - Lookup other webpages that have hyperlinks leading to effectpay.net.
Google Index - Which of the pages is Google.com indexing?
Find out which pages from effectpay.net have made it into Google.com’s listings. You can find out with the "site:" query.
Website on this IP by Bing - All sites on the same 207.154.212.138 IP
View a list of websites with an IP matching that of effectpay.net from Bing.com
Similar domain names
effectpedalgiveaway.comeffectpedalgiveaway.neteffectphotographer.comeffectpay.comeffectparticipants.loaneffectparking.com
You took 89.95 and 84.95 at the same time from my back account that i didnt authorize and was apparently hacked. I...