Fantasycricketnews.com Website Review


Make info private

Traffic and Value

Is fantasycricketnews.com legit?
Website Value $250
Alexa Rank 1689981
Monthly Visits 2769
Daily Visits 93
Monthly Earnings $13.85
Daily Earnings $0.46
Click Here for Full Review

Fantasycricketnews.com Server Location

Country: United States
Metropolitan Area: Scottsdale
Postal Reference Code: 85260
Latitude: 33.6013
Longitude: -111.8867




Summarized Content

asia cup match 6 – afghanistan v ba*gladesh – fcn preview. cpl final – guyana amazon warriors v trinbago knight riders – fantasy preview. cpl qualifier 2 – trinbago knight riders v st kitts and nevis patriots – fantasy preview. cpl eliminator – jamaica tallawahs v st kitts and nevis patriots – fantasy preview. with just two games remaining in the 2018 caribbean premier league, all four finalists are still alive in the competition as we... cpl qualifier 1 – trinbago knight riders v guyana amazon warriors – fantasy preview. its playoffs time in the cpl! first up we have the two best performing teams of the tournament fighting it out for.. bound to happen for some time now, england’s alastair cook finally called time on one of the more memorable test careers in... cpl match 28 – trinbago knight riders v barbados tridents – fantasy preview. this is a huge mismatch in terms of both teams positions in the cpl standings, it’s first versus sixth in what should... cpl match 27 – trinbago knight riders v guyana amazon warriors – fantasy preview. both these teams are in hot contention to finish on top of this year’s cpl points table with three games in hand... cpl match 26 – st kitts and nevis patriots v barbados tridents – fantasy preview. with a record of 0-5 on their home deck in cpl18 and a handful of consecutive losses, the barbados tridents may well... cpl match 21 – st kitts and nevis patriots v st lucia stars – fantasy preview. having played their final home game of the tournament against the tallawahs in cpl18, st lucia are near-certainties to finish on the... cpl match 20 – barbados tridents v jamaica tallawahs – fantasy preview. this matchup sees two of the more inconsistent outfits in this year’s cpl do battle. there was a period where the tallawahs... cpl match 19 – st kitts and nevis patriots v guyana amazon warriors – fantasy preview. sandwiched in the middle of the cpl points table, both the patriots and amazon warriors have a golden opportunity to potentially rise..


Fantasycricketnews Main Page Content

HTML Tag Content Informative?
Title: Fantasy Cricket News & Information | Dream11 Lineups | DFC | IPL Could be improved
Description: Fantasy Cricket News is your go-to place for fantasy cricket news and information. Keep current on the latest cricket news, IPL 2018 previews, odds and injury updates, and DFC and Dream11 fantasy team
H1: Is it informative enough?
H2: Asia Cup Match 6 – Afghanistan V Bangladesh – FCN Preview
H3: Featured NewsIs it informative enough?

Other Helpful Websites and Services for Fantasycricketnews

Internal Pages

/comments/feed/:
Title

Comments for Daily Fantasy Cricket News and Information

Description

Not defined

/category/news/:
Title

News Archives | Daily Fantasy Cricket News and Information

Description

Not defined

H2

Virat Kohli is No. 1 in ODI Batsman Rankings!

H3

Like FCN

/category/fantasy-previews/:
Title

Fantasy Previews Archives | Daily Fantasy Cricket News and Information

Description

Not defined

H2

4th Test – South Africa vs Australia – Fantasy Preview

H3

Like FCN

/category/entertainment/:
Title

Entertainment Archives | Daily Fantasy Cricket News and Information

Description

Not defined

H2

David Warner wants to shake hand with Joe Root at Walkabout bar

H3

Like FCN

/category/cricket-fun/:
Title

Cricket Fun Archives | Daily Fantasy Cricket News and Information

Description

Not defined

H2

MS Dhoni Rates Shoaib Akhtar as Toughest Bowler He Faced

H3

Like FCN

All the information about fantasycricketnews.com was collected from publicly available sources

Similar domain names

fantasycricketonline.comfantasycrickets.comfantasycricketstar.comfantasycricketmatches.netfantasycricketlive.comfantasycricketleagues.com



CAPTCHA ERROR
Recent Comments
Ronald Kurtz about trimbodymax.com
You took 89.95 and 84.95 at the same time from my back account that i didnt authorize and was apparently hacked. I...
Ester Joseph about repassists.com
Please refund my money back I never knew this am not interested
Jose Chavez about spoosk.com
Ive been charged for no reason this is fraud and want my money back!
CHANTREA BO about sitetaskreps.com
Good morning, Can you tell me what i have been charged for on 10/8/19 amount of $61..90 I believe this could be...
Leo Wickers IV about dotabon.com
Stop charging my account or police and better business bureau will be notified
tangi muzzo about attrdte.com
I need the money tht you took from my account.. I have no idea of what this site is all about.. Please return my...
Mthetheleli Peter about feemyd.com
This is a fraud I want my money back
motonobu matsubara about talentbrainstore.com
Please refund my 100yen and 10,000yen you took fraudulently as I never purchased or joined your site. Please cancel...
Selwyn Clarke about cartplay.com
Hi I sent an e-mail to you Thursday (nz) time and as yet I have had no response the number referred to is...
Nicolash Fernandes about ddos-guard.net
Knowing how reliable and secure DDoS protection service from ddos-guard.net, I have updated my plan with them and...
John about webtermdata.com
You have charged my credit card for $54.56 please add it back and cancel my subscription card ending 6485
DMCA.com Protection Status