Flatleyco.com receives about 799 visitors in one month. That could possibly earn $4 each month or $0.13 each day. Server of the website is located in the United States. Flatleyco.com main page was reached and loaded in 1.08 seconds. This is a good result. Try the services listed at the bottom of the page to search for available improvements.
Traffic and Value
| Is flatleyco.com legit? | |
| Website Value | $72 |
| Alexa Rank | 4536468 |
| Monthly Visits | 799 |
| Daily Visits | 27 |
| Monthly Earnings | $4 |
| Daily Earnings | $0.13 |
Flatleyco.com Server Location
Country: United States
Metropolitan Area: Culver City
Postal Reference Code: 90232
Latitude: 34.0141
Longitude: -118.3983
Summarized Content
Flatleyco Main Page Content
| HTML Tag | Content | Informative? |
|---|---|---|
| Title: | The Flatley Company | Office Space in Braintree MA, Charlestown MA, Quincy |  |
| Description: | Founded in 1959 by the late Thomas J. Flatley - The Flatley Company is a family held, fully integrated real estate company, located in Braintree, MA. In its | |
| H1: | The Flatley Company | Is it informative enough? |
We've noticed that you have issues with some content elements on the main page:
• Take a look at the headings; there might be too little information. Headings are important for usability and search engine optimization.
Other Helpful Websites and Services for Flatleyco
Results will appear here |
|
Pingdom - Web transfer-speed test from Pingdom
Run diagnostic transfer-rate tests on each page or individual page components (JS, .img, and HTML code) with Pingdom for flatleyco.com
Google’s Web Analytics Google provides many analytical tools for the web that will help you find out the number of visitors, their locations and activities when logging onto flatleyco.com
Alexa - flatleyco.com on Alexa Traffic Rank Data
Alexa provides a charting service that shows global position by audience, engagement, and time spent on flatleyco.com
Majestic Backlinks - Lookup other webpages that have hyperlinks leading to flatleyco.com.
Google Index - Which of the pages is Google.com indexing?
Find out which pages from flatleyco.com have made it into Google.com’s listings. You can find out with the "site:" query.
Website on this IP by Bing - All sites on the same 70.32.97.143 IP
View a list of websites with an IP matching that of flatleyco.com from Bing.com
Internal Pages
| /properties/braintree-hill-office-park/: | |
|---|---|
| Title |
Office space for lease in Braintree MA - Braintree Hill Office Park | The Flatley Company |
| Description |
Braintree Hill Office Park is considered one of Boston's most prestigious superparks. It is distinguished by its prime location close to Boston and the many |
| H1 |
Braintree Hill Office Park |
| H2 |
Space for lease |
| H3 |
Amenities |
| /properties/schraffts-city-center/: | |
|---|---|
| Title |
Schrafft's City Center | The Flatley Company |
| Description |
This legendary building at 529 Main Street in Charlestown was formerly the manufacturing site of the famous Schrafft's Candy Factory. It was purchased and |
| H1 |
Schrafft’s City Center |
| H2 |
Space for Lease |
| H3 |
Amenities |
| /properties/maritime-development-site/: | |
|---|---|
| Title |
Maritime Development Site | The Flatley Company |
| Description |
Maritime Site available on the water at 425 Schrafft's City Center in Charlestown, MA. The 5 acre site consists of 2 acres of land and 3 acres of water |
| H1 |
Maritime Development Site |
| H3 |
Amenities |
| /properties/crown-colony-office-park/: | |
|---|---|
| Title |
Crown Colony Office Park | The Flatley Company |
| Description |
Located 9 miles south of Boston, Crown Colony Office Park is a 143-acre office campus located in Quincy, close to the I-93 and Route 3 interchange. The park |
| H1 |
Crown Colony Office Park |
| H2 |
Development Sites |
| H3 |
Amenities |
| /properties/retail/: | |
|---|---|
| Title |
Retail | The Flatley Company |
| Description |
The Flatley Company's Retail Plaza is located at the entrance to Braintree Hill Office Park and is leased to the following tenants: Santander Bank, Men's |
| H1 |
Retail |
| H3 |
Amenities |
Similar domain names
flatleydesign.comflatleyfence.netflatleyprivatecapital.comflatleybarrywedding.comflatley.winflatley.party
Good morning, Can you tell me what i have been charged for on 10/8/19 amount of $61..90 I believe this could be...
Stop charging my account or police and better business bureau will be notified
I need the money tht you took from my account.. I have no idea of what this site is all about.. Please return my...
Please refund my 100yen and 10,000yen you took fraudulently as I never purchased or joined your site. Please cancel...
Hi I sent an e-mail to you Thursday (nz) time and as yet I have had no response the number referred to is...
Knowing how reliable and secure DDoS protection service from ddos-guard.net, I have updated my plan with them and...
You have charged my credit card for $54.56 please add it back and cancel my subscription card ending 6485
You took 89.95 and 84.95 at the same time from my back account that i didnt authorize and was apparently hacked. I...