Flytimetv.com receives about 12279 visitors in one month. That could possibly earn $61.4 each month or $2.05 each day. Server of the website is located in the United States. Flytimetv.com main page was reached and loaded in 1.47 seconds. This is a good result. Try the services listed at the bottom of the page to search for available improvements.
Is flytimetv.com legit? | |
Website Value | $1106 |
Alexa Rank | 614576 |
Monthly Visits | 12279 |
Daily Visits | 410 |
Monthly Earnings | $61.4 |
Daily Earnings | $2.05 |
Country: United States
Metropolitan Area: Not defined
Postal Reference Code: Not defined
Latitude: 37.751
Longitude: -97.822
HTML Tag | Content | Informative? |
---|---|---|
Title: | Flytime TV – Authentic African Entertainment Content | Could be improved |
Description: | Not set | Empty |
H2: | Singer, Orezi Acquires Luxurious Mercedes Benz As Christmas Gift (Photos) |
Results will appear here |
|
Pingdom - Web transfer-speed test from Pingdom
Run diagnostic transfer-rate tests on each page or individual page components (JS, .img, and HTML code) with Pingdom for flytimetv.com
Google’s Web Analytics Google provides many analytical tools for the web that will help you find out the number of visitors, their locations and activities when logging onto flytimetv.com
Alexa - flytimetv.com on Alexa Traffic Rank Data
Alexa provides a charting service that shows global position by audience, engagement, and time spent on flytimetv.com
Majestic Backlinks - Lookup other webpages that have hyperlinks leading to flytimetv.com.
Google Index - Which of the pages is Google.com indexing?
Find out which pages from flytimetv.com have made it into Google.com’s listings. You can find out with the "site:" query.
Website on this IP by Bing - All sites on the same 62.151.176.28 IP
View a list of websites with an IP matching that of flytimetv.com from Bing.com
/2018/12/26/singer-orezi-acquires-luxurious-mercedes-benz-as-christmas-gift-photos/: | |
---|---|
Title |
Singer, Orezi Acquires Luxurious Mercedes Benz As Christmas Gift (Photos) – Flytime TV |
Description |
Not defined |
H1 |
Singer, Orezi Acquires Luxurious Mercedes Benz As Christmas Gift (Photos) |
H2 |
Christmas Day Netflix List: What To Watch For The Holiday |
H3 |
Cancel reply |
/2018/12/25/christmas-day-netflix-list-what-to-watch-for-the-holiday/: | |
---|---|
Title |
Christmas Day Netflix List: What To Watch For The Holiday – Flytime TV |
Description |
Not defined |
H1 |
Christmas Day Netflix List: What To Watch For The Holiday |
H2 |
Merry Christmas!! Time for some Netflix, family and chill. |
H3 |
Cancel reply |
/2018/12/25/kevin-spacey-returns-in-strange-video-faces-charges-for [censorship] ual- [censorship] ault/: | |
---|---|
Title |
Kevin Spacey Returns In Strange Video, Faces Charges For ual ault – Flytime TV [censored]
|
Description |
Not defined |
H1 |
Kevin Spacey Returns In Strange Video, Faces Charges For ual ault [censored]
|
H2 |
Kevin Spacey speaks as Frank Underwood in the truly bizarre clip. |
H3 |
Cancel reply |
/2018/12/25/omarion-exposed-by-his-baby-mother-apryl-jones-in-fierce-video-rant/: | |
---|---|
Title |
Omarion Exposed By His Baby Mother Apryl Jones In Fierce Video Rant – Flytime TV |
Description |
Not defined |
H1 |
Omarion Exposed By His Baby Mother Apryl Jones In Fierce Video Rant |
H2 |
“I’ve protected that man for 3 years and I gave up 5 years for that relationship.” |
H3 |
Cancel reply |
/2018/12/25/american-singer-miley-cyrus-actor-liam-hemsworth-tie-the-knot-on-a-low-key-photos/: | |
---|---|
Title |
American Singer, Miley Cyrus & Actor Liam Hemsworth Tie The Knot On A Low Key (Photos) – Flytime TV |
Description |
Not defined |
H1 |
American Singer, Miley Cyrus & Actor Liam Hemsworth Tie The Knot On A Low Key (Photos) |
H2 |
Singer, Orezi Acquires Luxurious Mercedes Benz As Christmas Gift (Photos) |
H3 |
Cancel reply |
Similar domain names
flytimexv.comflytimezz.comflytimor.comflytimetravels.comflytimetravel.netflytimetrampolinepark.com
You took 89.95 and 84.95 at the same time from my back account that i didnt authorize and was apparently hacked. I...