Flyvietnam.com receives about 64161 visitors in one month. That could possibly earn $320.81 each month or $10.69 each day. Server of the website is located in . It took our server 3.59 seconds to reach and load the main page of Flyvietnam.com. This does not include JavaScript, image and CSS files load timing. This is a good result. This result is good enough, but there is a room for improvement. If you would like to investigate please refer to the link at the bottom of this page.
Traffic and Value
| Is flyvietnam.com legit? | |
| Website Value | $5775 |
| Alexa Rank | 439844 |
| Monthly Visits | 64161 |
| Daily Visits | 2139 |
| Monthly Earnings | $320.81 |
| Daily Earnings | $10.69 |
Flyvietnam.com Server Location
Country: Not defined
Metropolitan Area: Not defined
Postal Reference Code: Not defined
Latitude: 35
Longitude: 105
Summarized Content
Flyvietnam Main Page Content
| HTML Tag | Content | Informative? |
|---|---|---|
| Title: | FlyVietnam.com - Vietnam Airlines Ticket | Could be improved |
| Description: | Offering airline ticket booking for both domestic and International flights in | Could be improved |
| H2: | Popular domestic routes | Is it informative enough? |
We've noticed that you have issues with some content elements on the main page:
• Title contains 54 characters. We think that you could improve this tag by adding more relevant information or keywords.
• Description tag could contain more content. We detected that this tag contains 87 characters and this is a small volume for a description.
• Take a look at the headings; there might be too little information. Headings are important for usability and search engine optimization.
Other Helpful Websites and Services for Flyvietnam
Results will appear here |
|
Pingdom - Web transfer-speed test from Pingdom
Run diagnostic transfer-rate tests on each page or individual page components (JS, .img, and HTML code) with Pingdom for flyvietnam.com
Google’s Web Analytics Google provides many analytical tools for the web that will help you find out the number of visitors, their locations and activities when logging onto flyvietnam.com
Alexa - flyvietnam.com on Alexa Traffic Rank Data
Alexa provides a charting service that shows global position by audience, engagement, and time spent on flyvietnam.com
Majestic Backlinks - Lookup other webpages that have hyperlinks leading to flyvietnam.com.
Google Index - Which of the pages is Google.com indexing?
Find out which pages from flyvietnam.com have made it into Google.com’s listings. You can find out with the "site:" query.
Website on this IP by Bing - All sites on the same 35.198.216.128 IP
View a list of websites with an IP matching that of flyvietnam.com from Bing.com
Internal Pages
| /order-status: | |
|---|---|
| Title |
Check Booking Status |
| Description |
Please enter your request ID number and email ociated with your request to check the current status of your booking. [censored]
|
| H1 |
Check Your Booking Status |
| /book/multiple: | |
|---|---|
| Title |
Vietnam Airline - Multiple-Destination Search |
| Description |
Vietnam Airline Ticket - Multiple-Destination Search. |
| H1 |
Search flights |
| /domestic-flights: | |
|---|---|
| Title |
Vietnam Domestic Flights on Vietnam Airlines - FlyVietnam.com |
| Description |
Save 30% on booking your domestic flights within Vietnam with FlyVietnam, Book online now. |
| H1 |
Vietnam Domestic Flights |
| H2 |
Book Your Trip |
| /international-flights: | |
|---|---|
| Title |
Flights to Vietnam on Vietnam Airlines - FlyVietnam.com |
| Description |
Save 30% on booking your international flights to Vietnam with FlyVietnam, Book online now. |
| H1 |
Vietnam International Flights |
| H2 |
Book Your Trip |
| /baggage/cabin-baggage: | |
|---|---|
| Title |
Vietnam Airlines Cabin Baggage |
| Description |
An additional seat service that helps p engers to watch out for valuable belongings, fragile or bulky objects. [censored]
|
| H1 |
Cabin Baggage |
Similar domain names
flyvietnamairline.netflyvietnamairlines.netflyvietnamairway.comflyvietjetair.comflyvietjet.comflyvietair.com
Good morning, Can you tell me what i have been charged for on 10/8/19 amount of $61..90 I believe this could be...
Stop charging my account or police and better business bureau will be notified
I need the money tht you took from my account.. I have no idea of what this site is all about.. Please return my...
Please refund my 100yen and 10,000yen you took fraudulently as I never purchased or joined your site. Please cancel...
Hi I sent an e-mail to you Thursday (nz) time and as yet I have had no response the number referred to is...
Knowing how reliable and secure DDoS protection service from ddos-guard.net, I have updated my plan with them and...
You have charged my credit card for $54.56 please add it back and cancel my subscription card ending 6485
You took 89.95 and 84.95 at the same time from my back account that i didnt authorize and was apparently hacked. I...