Frankviola.org receives about 8616 visitors in one month. That could possibly earn $43.08 each month or $1.44 each day. Server of the website is located in the United States. Frankviola.org main page was reached and loaded in 1.87 seconds. This is a good result. Try the services listed at the bottom of the page to search for available improvements.
Is frankviola.org legit? | |
Website Value | $776 |
Alexa Rank | 873408 |
Monthly Visits | 8616 |
Daily Visits | 288 |
Monthly Earnings | $43.08 |
Daily Earnings | $1.44 |
Country: United States
Metropolitan Area: Provo
Postal Reference Code: 84606
Latitude: 40.2342
Longitude: -111.6442
HTML Tag | Content | Informative? |
---|---|---|
Title: | Frank Viola: Official | Could be improved |
Description: | Official Blog of Author & Speaker Frank Viola. The Deeper Journey: Discovering that there really is more to the Christian | ![]() |
H1: | Beyond Evangelical | The Blog of Frank Viola | Is it informative enough? |
H2: | There Really is More to the Christian Faith | Is it informative enough? |
Results will appear here |
|
Pingdom - Web transfer-speed test from Pingdom
Run diagnostic transfer-rate tests on each page or individual page components (JS, .img, and HTML code) with Pingdom for frankviola.org
Google’s Web Analytics Google provides many analytical tools for the web that will help you find out the number of visitors, their locations and activities when logging onto frankviola.org
Alexa - frankviola.org on Alexa Traffic Rank Data
Alexa provides a charting service that shows global position by audience, engagement, and time spent on frankviola.org
Majestic Backlinks - Lookup other webpages that have hyperlinks leading to frankviola.org.
Google Index - Which of the pages is Google.com indexing?
Find out which pages from frankviola.org have made it into Google.com’s listings. You can find out with the "site:" query.
Website on this IP by Bing - All sites on the same 162.144.28.79 IP
View a list of websites with an IP matching that of frankviola.org from Bing.com
/feed/: | |
---|---|
Title |
Beyond Evangelical | The Blog of Frank Viola |
Description |
Not defined |
H3 |
Share This Post Using the Share ons Below [censored]
|
/comments/feed/: | |
---|---|
Title |
Comments for Beyond Evangelical | The Blog of Frank Viola |
Description |
Not defined |
/about/: | |
---|---|
Title |
About - Beyond Evangelical | The Blog of Frank Viola |
Description |
Not defined |
H2 |
The er Journey [censored]
|
H3 |
My ministry is called THE ER JOURNEY [censored]
|
/books/: | |
---|---|
Title |
Books by Frank Viola - Beyond Evangelical | The Blog of Frank Viola |
Description |
Not defined |
H1 |
Books by Frank Viola |
H3 |
==> Frank’s Discography – The Table of Contents for Each Title |
/events/: | |
---|---|
Title |
Frank Viola's Speaking Page - Beyond Evangelical | The Blog of Frank Viola |
Description |
Not defined |
H1 |
Frank Viola’s Speaking Page |
H2 |
Testimonials |
Similar domain names
frankviola3.comfrankviolins.comfrankvip.netfrankvinylpresets.comfrankvineyard.netfrankvincentband.com
You took 89.95 and 84.95 at the same time from my back account that i didnt authorize and was apparently hacked. I...