Gatewaypediatricdentistry.com Website Review


Make info private

Traffic and Value

Is gatewaypediatricdentistry.com legit?
Website Value $21
Alexa Rank 15810342
Monthly Visits 227
Daily Visits 8
Monthly Earnings $1.14
Daily Earnings $0.04
Click Here for Full Review

Gatewaypediatricdentistry.com Server Location

Country: United States
Metropolitan Area: Not defined
Postal Reference Code: Not defined
Latitude: 37.751
Longitude: -97.822




Summarized Content

At Gateway Pediatric Dentistry, our team of dedicated dental health professionals is here to serve you. Gateway Pediatric Dentistry was established in 2009 and have been providing compas*ionate, friendly professional dental care to the community and surrounding areas ever since. Each of our dentists are registered specialists in pediatric dentistry whom after graduating from dental school have obtained two to three years of additional training from an accredited education program in pediatric dentistry beyond their dental degree. Visits to the dentist can often be overwhelming for children. As such, our helpful and professional staff are dedicated to making the experience as seamless and comfortable as possible for you and your child. On our website, you will find the full spectrum of services Gateway Pediatric Dentistry offers. You also have the option to complete your child's new patient forms prior to your first visit, in order to help you and your child feel prepared and comfortable. Once you arrive at Gateway Pediatric Dentistry, we will do our best to put both you and your child at ease so that their scheduled visits to the dentist are something to look forward to! If you have any questions about how we can care for your child's teeth please do not hesitate to call us at We encourage you to contact us with any questions or comments you may have. Please call our office or use the quick contact form below. Please enter a name! Invalid Email Address Email or Phone Required


Gatewaypediatricdentistry Main Page Content

HTML Tag Content Informative?
Title: Welcome | Edmonton, Alberta | Gateway Pediatric Could be improved
Description: Welcome to our Welcome page. Contact Gateway Pediatric Dentistry today at (780) 705-KIDS or visit our office servicing Edmonton,
H2: WelcomeIs it informative enough?

Other Helpful Websites and Services for Gatewaypediatricdentistry

Internal Pages

/appointment-request/:
Title

Appointment Request | Edmonton, Alberta | Gateway Pediatric Dentistry

Description

Welcome to our Appointment Request page. Contact Gateway Pediatric Dentistry today at (780) 705-KIDS or visit our office servicing Edmonton, Alberta

H2

Appointment Request

/contact/:
Title

Contact | Edmonton, Alberta | Gateway Pediatric Dentistry

Description

Welcome to our Contact page. Contact Gateway Pediatric Dentistry today at (780) 705-KIDS or visit our office servicing Edmonton, Alberta

H2

Contact

/our-practice/:
Title

Our Practice | Edmonton, Alberta | Gateway Pediatric Dentistry

Description

Welcome to our Our Practice page. Contact Gateway Pediatric Dentistry today at (780) 705-KIDS or visit our office servicing Edmonton, Alberta

H2

Our Practice

/our-practice/office-tour/:
Title

Office Tour | Edmonton, Alberta | Gateway Pediatric Dentistry

Description

Welcome to our Office Tour page. Contact Gateway Pediatric Dentistry today at (780) 705-KIDS or visit our office servicing Edmonton, Alberta

H2

Office Tour

All the information about gatewaypediatricdentistry.com was collected from publicly available sources

Similar domain names

gnpmedlab.comupdate-manualgrallumbo.comupdate-manualgatewaypediatricsltd.comgatewaypediatricsurgery.comgatewaypennsy.netgatewaypeakperformance.comgatewaypd.comgatewaypcx.com



CAPTCHA ERROR
Recent Comments
Ronald Kurtz about trimbodymax.com
You took 89.95 and 84.95 at the same time from my back account that i didnt authorize and was apparently hacked. I...
Ester Joseph about repassists.com
Please refund my money back I never knew this am not interested
Jose Chavez about spoosk.com
Ive been charged for no reason this is fraud and want my money back!
CHANTREA BO about sitetaskreps.com
Good morning, Can you tell me what i have been charged for on 10/8/19 amount of $61..90 I believe this could be...
Leo Wickers IV about dotabon.com
Stop charging my account or police and better business bureau will be notified
tangi muzzo about attrdte.com
I need the money tht you took from my account.. I have no idea of what this site is all about.. Please return my...
Mthetheleli Peter about feemyd.com
This is a fraud I want my money back
motonobu matsubara about talentbrainstore.com
Please refund my 100yen and 10,000yen you took fraudulently as I never purchased or joined your site. Please cancel...
Selwyn Clarke about cartplay.com
Hi I sent an e-mail to you Thursday (nz) time and as yet I have had no response the number referred to is...
Nicolash Fernandes about ddos-guard.net
Knowing how reliable and secure DDoS protection service from ddos-guard.net, I have updated my plan with them and...
John about webtermdata.com
You have charged my credit card for $54.56 please add it back and cancel my subscription card ending 6485
DMCA.com Protection Status