Keepitsafe.com receives about 18912 visitors in one month. That could possibly earn $94.56 each month or $3.15 each day. Server of the website is located in the United States. Keepitsafe.com main page was reached and loaded in 0.71 seconds. This is a good result. Try the services listed at the bottom of the page to search for available improvements.
Is keepitsafe.com legit? | |
Website Value | $1703 |
Alexa Rank | 400398 |
Monthly Visits | 18912 |
Daily Visits | 631 |
Monthly Earnings | $94.56 |
Daily Earnings | $3.15 |
Country: United States
Metropolitan Area: Not defined
Postal Reference Code: Not defined
Latitude: 37.751
Longitude: -97.822
HTML Tag | Content | Informative? |
---|---|---|
Title: | KeepItSafe (US) | Online Cloud Data Backup and Disaster | Could be improved |
Description: | Secure Business Cloud Backup & Disaster Recovery Solutions from KeepItSafe - Fully managed with 24/7 support & customer service to help keep your critical data | |
H1: | KeepItSafe® Cloud Backup & Recovery Solutions | |
H2: | Holistic Disaster Recovery | Is it informative enough? |
H3: | – From Data Center to Endpoint – | Is it informative enough? |
Results will appear here |
|
Pingdom - Web transfer-speed test from Pingdom
Run diagnostic transfer-rate tests on each page or individual page components (JS, .img, and HTML code) with Pingdom for keepitsafe.com
Google’s Web Analytics Google provides many analytical tools for the web that will help you find out the number of visitors, their locations and activities when logging onto keepitsafe.com
Alexa - keepitsafe.com on Alexa Traffic Rank Data
Alexa provides a charting service that shows global position by audience, engagement, and time spent on keepitsafe.com
Majestic Backlinks - Lookup other webpages that have hyperlinks leading to keepitsafe.com.
Google Index - Which of the pages is Google.com indexing?
Find out which pages from keepitsafe.com have made it into Google.com’s listings. You can find out with the "site:" query.
Website on this IP by Bing - All sites on the same 2600:1402:a:2a1::21dc IP
View a list of websites with an IP matching that of keepitsafe.com from Bing.com
/ca/: | |
---|---|
Title |
KeepItSafe (CA) | Online Cloud Data Backup and Disaster Recovery |
Description |
Secure Business Cloud Backup & Disaster Recovery Solutions from KeepItSafe - Fully managed with 24/7 support & customer service to help keep your critical data safe. |
H1 |
Cloud Backup & Disaster Recovery with Veeam Cloud Connect |
H2 |
Protect Your Critical Business Data |
H3 |
Global Cloud Data Availability for the Always-On Enterprise |
/uk/: | |
---|---|
Title |
KeepItSafe (UK) | Online Cloud Data Backup and Disaster Recovery |
Description |
Secure Business Cloud Backup & Disaster Recovery Solutions from KeepItSafe - Fully managed with 24/7 support & customer service to help keep your critical data safe. |
H1 |
Cloud Backup & Disaster Recovery with Veeam Cloud Connect |
H2 |
Protect Your Critical Business Data |
H3 |
Global Cloud Data Availability for the Always-On Enterprise |
/ie/: | |
---|---|
Title |
KeepItSafe (IE) | Online Cloud Data Backup and Disaster Recovery |
Description |
Secure Business Cloud Backup & Disaster Recovery Solutions from KeepItSafe - Fully managed with 24/7 support & customer service to help keep your critical data safe. |
H1 |
Cloud Backup & Disaster Recovery with Veeam Cloud Connect |
H2 |
Protect Your Critical Business Data |
H3 |
Global Cloud Data Availability for the Always-On Enterprise |
/is/: | |
---|---|
Title |
KeepItSafe (IS) | Online Cloud Data Backup and Disaster Recovery |
Description |
Secure Business Cloud Backup & Disaster Recovery Solutions from KeepItSafe - Fully managed with 24/7 support & customer service to help keep your critical data safe. |
H1 |
Cloud Backup & Disaster Recovery with Veeam Cloud Connect |
H2 |
Protect Your Critical Business Data |
H3 |
Global Cloud Data Availability for the Always-On Enterprise |
/au/: | |
---|---|
Title |
KeepItSafe (AU) | Online Cloud Data Backup and Disaster Recovery |
Description |
Secure Business Cloud Backup & Disaster Recovery Solutions from KeepItSafe - Fully managed with 24/7 support & customer service to help keep your critical data safe. |
H1 |
Cloud Backup & Disaster Recovery with Veeam Cloud Connect |
H2 |
Global Cloud Data Availability |
H3 |
Global Cloud Data Availability for the Always-On Enterprise |
Similar domain names
keepitsafe.watchkeepitsafeonline.comkeepitsafephilly.netkeepitsacredsupplies.comkeepits.comkeepitruralmcga.org
You took 89.95 and 84.95 at the same time from my back account that i didnt authorize and was apparently hacked. I...