Kingmovie2.pw Website Review


Make info private

Traffic and Value

Is kingmovie2.pw legit?
Website Value $300
Alexa Rank 1406009
Monthly Visits 3333
Daily Visits 112
Monthly Earnings $16.67
Daily Earnings $0.56
Click Here for Full Review

Kingmovie2.pw Server Location

Country: United States
Metropolitan Area: Not defined
Postal Reference Code: Not defined
Latitude: 37.751
Longitude: -97.822




Summarized Content

King Mooe KINGMOVIE Do*nload movie and serial Direct Link Date Registration Release Date Points Rate Members Number of Votes IMDB Fee Generate sales hits Visits above 9 above 8.5 over 8 over 7.5 over 7 over 6 over 5 under 5 all over 9 over 8.5 over 8 over 7.5 over 7 over 6 over 5 under 5 all over 90 over 80 over 70 over 60 over 50 Under 50 All suitable for all ages suitable for ages over 13 years of age and over. All BDRipBluRay 1080pBluRay 1080p 3DBluRay 1080p Full HDBluRay 1080p Full HD 3DBluRay 1080p mHDBluRay 1080p x265BluRay 2160p 4KBluRay 480pBluRay 720pBluRay 720p 3DBluRay 720p HDBluRay 720p mHDBluRay 720p x264BluRay 720p x265CAMDVDRipDVDRip 720pDVDScrDVDScr 720pHDCAMHDCAM 720pHDRipHDRip 1080pHDRip 720pHDTSHDTS 720pHDTVHDTV 1080pHDTV 480pHDTV 720pHDTV 720p x265TSTS 720pTVRipVHSRipWEB-DLWEB-DL 1080pWEB-DL 1080p HQWEB-DL 2160p 4KWEB-DL 480pWEB-DL 720pWEB-DL 720p x265WEBRipWEBRip 1080pWEBRip 2160p 4KWEBRip 720pWEBRip 720p x265 ArmeniaBa*gladeshPuerto Rico Zrbayjanarzhantynafryqay Jnvbalbanyalman*lman Shrqyalman Ghrbyamrykaathad Shvrvyatrshyarvgvyhaspanyaastralyaastvnyaslvakyaslvvnyafghanstan*ljzayralsalvadvramaratandvnzyanglstanavkraynavgandaaytalyaayranayrlndayslndbahamabrzylbrmvdablzhykblgharstanbvtsvanabvsny Union Hrzgvynbvlyvypakstanpanamaprtghalprvplynzy France Tanzanyataylndtayvantrkyhtvnsjmhvry shop Chkjmhvry Mqdvnyhchkslvakychyndanmarkrvsyhrvmanyzymbavhzhapnsrylankasngapvrsvydsvyyssvdansvryhsvmalyshylysrbstanrbstan


Kingmovie2 Main Page Content

HTML Tag Content Informative?
Title: KING MOVE kingmovie Could be improved
Description: Kingmovie Kingmovie The most comprehensive for movie and serials with Persian dubbing and omitted, 2018 movie 2017 movie
H1: direct link MOVE kingmovie Is it informative enough?
H2: Skate Kitchen (2018) Is it informative enough?
H3: ZZH1ZZ | ZH3Z with ZZH1ZZ | ZH3Z ZZTITLEZ | ZDZCRZ Kingmovie | Kingmovie The most comprehensive for movie and serials with Persian dubb

Other Helpful Websites and Services for Kingmovie2

Internal Pages

/?orderBy=7&pageSizeLimit=50&pageId=2:
Title

King Movie kingmovie movies and TV shows direct link

[censored]

Description

King Movie kingmovie most comprehensive site to movies and series dubbed in Farsi and omissions, Movies 2018, Movies 2017, movies direct link

[censored]

H2

Bad Times at the El Royale (2018)

H3

along with Persian dubbing and omitted (bilingual)

[censored]

/?orderBy=8&pageSizeLimit=200&pageId=3:
Description

Not defined

H2

Skate Kitchen ( 2018 )

/?from=2018&to=2018&oB=3&minVotes=2000:
Description

Kingmovie Kingmovie The most comprehensive site for movie and serials with Persian dubbing and and omitted, 2018 movie , 2017 movie ,

[censored]

H3

along with the Persian version of the dubbing and omitted (bilingual)

[censored]

All the information about kingmovie2.pw was collected from publicly available sources

Similar domain names

kingmovie21.comkingmovie2k.comkingmovie39.comkingmovie10.comkingmovie.xyzkingmovie.win



CAPTCHA ERROR
Recent Comments
Ronald Kurtz about trimbodymax.com
You took 89.95 and 84.95 at the same time from my back account that i didnt authorize and was apparently hacked. I...
Ester Joseph about repassists.com
Please refund my money back I never knew this am not interested
Jose Chavez about spoosk.com
Ive been charged for no reason this is fraud and want my money back!
CHANTREA BO about sitetaskreps.com
Good morning, Can you tell me what i have been charged for on 10/8/19 amount of $61..90 I believe this could be...
Leo Wickers IV about dotabon.com
Stop charging my account or police and better business bureau will be notified
tangi muzzo about attrdte.com
I need the money tht you took from my account.. I have no idea of what this site is all about.. Please return my...
Mthetheleli Peter about feemyd.com
This is a fraud I want my money back
motonobu matsubara about talentbrainstore.com
Please refund my 100yen and 10,000yen you took fraudulently as I never purchased or joined your site. Please cancel...
Selwyn Clarke about cartplay.com
Hi I sent an e-mail to you Thursday (nz) time and as yet I have had no response the number referred to is...
Nicolash Fernandes about ddos-guard.net
Knowing how reliable and secure DDoS protection service from ddos-guard.net, I have updated my plan with them and...
John about webtermdata.com
You have charged my credit card for $54.56 please add it back and cancel my subscription card ending 6485
DMCA.com Protection Status