Parkregiscitycentre.com.au Website Review


Make info private

Traffic and Value

Is parkregiscitycentre.com.au legit?
Website Value $74
Alexa Rank 4457787
Monthly Visits 813
Daily Visits 28
Monthly Earnings $4.07
Daily Earnings $0.14
Click Here for Full Review

Parkregiscitycentre.com.au Server Location

Country: United States
Metropolitan Area: Mountain View
Postal Reference Code: 94043
Latitude: 37.4043
Longitude: -122.0748




Summarized Content

Sign up for our email newsletter and receive specials and offers delivered straight to your inbox! MaartenSlovakiaSloveniaSolomon IslandsSomaliaSouth AfricaSpainSri LankaSudanSudan, This field is for validation purposes and should be left unchanged. This iframe contains the logic required to handle AJAX powered Gravity Forms. style with modern amenities such Wi-Fi, Foxtel and LCD televisions to ensure your experience is one to remember. features a king size bed,a 32-inch flat-screen TV and a private bathroom.  Max 2 guest. Roo.. and lounge area with fold out couch. A studio style room that is more s.. features King bed. More spacious than the standard rooms with partial Hyde Park View. Room.. best health, fitness and leisure facilities right at your fingertips. sometimes the meals and meetings can catch up with us all, why not try one of the local gyms listed below. Our friendly staff can provide suggestions for conference centres or meeting rooms for all your business-related requirements. Park Regis City Centre offers essential services to both our business and leisure guests who may require as*istance. its world-clas* reputation for quality seafood and fresh produce. From fine dining to cheap eats, you will be spoilt for choice! With top baristas and your bean of choice on practically every corner, you'll be as*ured of the pick-me-up you need for your daily leisure or PARK REGIS CITY CENTRE is surrounded by Sydney’s best shopping, restaurants, sightseeing and entertainment, cannot be beaten for Providing 122 rooms, Park Regis City Centre offers guests a range of room choices from the short stop over Express Rooms to our Park Suites with their own lounge area. All rooms have air conditioning, a work desk, broadband cable connections, WiFi access, LCD television and Our guests are invited to experience our rooftop outdoor pool and sundeck that affords magnificent 360 degree views over Sydney Harbour, Park Regis City Centre is designed to cater for both corporate and leisure travellers and is located in the heart of Sydney city, just a


Parkregiscitycentre Main Page Content

HTML Tag Content Informative?
Title: Park Regis City Centre Hotel Sydney - Cheap CBD Accommodation Near Town
Description: Book Direct and Save. Park Regis City Centre is Sydney's most centrally located Hotel for the budget traveller. Based in the heart of Sydney
H2: Park Regis City Centre, SydneyIs it informative enough?
H3: Subscribe to our newsletterIs it informative enough?

Other Helpful Websites and Services for Parkregiscitycentre

Internal Pages

/welcome-park-regis-city-centre-sydney/feed/:
Title

Comments on: Welcome to Park Regis City Centre, Sydney

Description

Not defined

/contact-us/:
Title

Contact Us | Park Regis City Centre - Sydney

Description

Not defined

H2

Contact Us

H3

Subscribe to our newsletter

/health-leisure/:
Title

Health, Fitness & Leisure Facilities | Park Regis City Centre - Sydney

Description

Park Regis City Centre's central CBD location ensures you have all the best health, fitness and leisure facilities right at your fingertips.

H2

Health, Fitness & Leisure Facilities

H3

Subscribe to our newsletter

/dining-bars/:
Title

Dining + Bars | Park Regis City Centre - Sydney

Description

Park Regis City Centre is surrounded by restaurants, bars and cafes to suit all tastes and budgets.

H2

Dining + Bars

H3

Subscribe to our newsletter

/functions-events/:
Title

Functions + Events | Park Regis City Centre - Sydney

Description

Not defined

H2

Functions + Events

H3

Subscribe to our newsletter

All the information about parkregiscitycentre.com.au was collected from publicly available sources

Similar domain names

parkregiscitycentre.reviewparkregisfinancial.comparkregisgreaternoida.comparkregisarion.comparkregionalicehockey.comparkregion.net



CAPTCHA ERROR
Recent Comments
Ronald Kurtz about trimbodymax.com
You took 89.95 and 84.95 at the same time from my back account that i didnt authorize and was apparently hacked. I...
Ester Joseph about repassists.com
Please refund my money back I never knew this am not interested
Jose Chavez about spoosk.com
Ive been charged for no reason this is fraud and want my money back!
CHANTREA BO about sitetaskreps.com
Good morning, Can you tell me what i have been charged for on 10/8/19 amount of $61..90 I believe this could be...
Leo Wickers IV about dotabon.com
Stop charging my account or police and better business bureau will be notified
tangi muzzo about attrdte.com
I need the money tht you took from my account.. I have no idea of what this site is all about.. Please return my...
Mthetheleli Peter about feemyd.com
This is a fraud I want my money back
motonobu matsubara about talentbrainstore.com
Please refund my 100yen and 10,000yen you took fraudulently as I never purchased or joined your site. Please cancel...
Selwyn Clarke about cartplay.com
Hi I sent an e-mail to you Thursday (nz) time and as yet I have had no response the number referred to is...
Nicolash Fernandes about ddos-guard.net
Knowing how reliable and secure DDoS protection service from ddos-guard.net, I have updated my plan with them and...
John about webtermdata.com
You have charged my credit card for $54.56 please add it back and cancel my subscription card ending 6485
DMCA.com Protection Status