Parkregiscitycentre.com.au receives about 813 visitors in one month. That could possibly earn $4.07 each month or $0.14 each day. Server of the website is located in the United States. Parkregiscitycentre.com.au main page was reached and loaded in 1.8 seconds. This is a good result. Try the services listed at the bottom of the page to search for available improvements.
Is parkregiscitycentre.com.au legit? | |
Website Value | $74 |
Alexa Rank | 4457787 |
Monthly Visits | 813 |
Daily Visits | 28 |
Monthly Earnings | $4.07 |
Daily Earnings | $0.14 |
Country: United States
Metropolitan Area: Mountain View
Postal Reference Code: 94043
Latitude: 37.4043
Longitude: -122.0748
HTML Tag | Content | Informative? |
---|---|---|
Title: | Park Regis City Centre Hotel Sydney - Cheap CBD Accommodation Near Town | |
Description: | Book Direct and Save. Park Regis City Centre is Sydney's most centrally located Hotel for the budget traveller. Based in the heart of Sydney | |
H2: | Park Regis City Centre, Sydney | Is it informative enough? |
H3: | Subscribe to our newsletter | Is it informative enough? |
Results will appear here |
|
Pingdom - Web transfer-speed test from Pingdom
Run diagnostic transfer-rate tests on each page or individual page components (JS, .img, and HTML code) with Pingdom for parkregiscitycentre.com.au
Google’s Web Analytics Google provides many analytical tools for the web that will help you find out the number of visitors, their locations and activities when logging onto parkregiscitycentre.com.au
Alexa - parkregiscitycentre.com.au on Alexa Traffic Rank Data
Alexa provides a charting service that shows global position by audience, engagement, and time spent on parkregiscitycentre.com.au
Majestic Backlinks - Lookup other webpages that have hyperlinks leading to parkregiscitycentre.com.au.
Google Index - Which of the pages is Google.com indexing?
Find out which pages from parkregiscitycentre.com.au have made it into Google.com’s listings. You can find out with the "site:" query.
Website on this IP by Bing - All sites on the same 104.199.118.119 IP
View a list of websites with an IP matching that of parkregiscitycentre.com.au from Bing.com
/welcome-park-regis-city-centre-sydney/feed/: | |
---|---|
Title |
Comments on: Welcome to Park Regis City Centre, Sydney |
Description |
Not defined |
/contact-us/: | |
---|---|
Title |
Contact Us | Park Regis City Centre - Sydney |
Description |
Not defined |
H2 |
Contact Us |
H3 |
Subscribe to our newsletter |
/health-leisure/: | |
---|---|
Title |
Health, Fitness & Leisure Facilities | Park Regis City Centre - Sydney |
Description |
Park Regis City Centre's central CBD location ensures you have all the best health, fitness and leisure facilities right at your fingertips. |
H2 |
Health, Fitness & Leisure Facilities |
H3 |
Subscribe to our newsletter |
/dining-bars/: | |
---|---|
Title |
Dining + Bars | Park Regis City Centre - Sydney |
Description |
Park Regis City Centre is surrounded by restaurants, bars and cafes to suit all tastes and budgets. |
H2 |
Dining + Bars |
H3 |
Subscribe to our newsletter |
/functions-events/: | |
---|---|
Title |
Functions + Events | Park Regis City Centre - Sydney |
Description |
Not defined |
H2 |
Functions + Events |
H3 |
Subscribe to our newsletter |
Similar domain names
parkregiscitycentre.reviewparkregisfinancial.comparkregisgreaternoida.comparkregisarion.comparkregionalicehockey.comparkregion.net
You took 89.95 and 84.95 at the same time from my back account that i didnt authorize and was apparently hacked. I...