Playhavensf.com Website Review


Make info private

Traffic and Value

Is playhavensf.com legit?
Website Value $246
Alexa Rank 1716562
Monthly Visits 2726
Daily Visits 91
Monthly Earnings $13.63
Daily Earnings $0.45
Click Here for Full Review

Playhavensf.com Server Location

Country: United States
Metropolitan Area: New York
Postal Reference Code: 10013
Latitude: 40.7157
Longitude: -74




Summarized Content

Play Haven is San Francisco’s newest indoor learn & play center, where children and families come together to explore, create, and have Our mission is to provide an inspiring space for imaginative play that promotes social and emotional development, and serves as a gathering Here you will find everything from art and sensory activities, to imaginative games and dramatic play areas, and even a rock climbing wall. We also host children's birthday parties in our private party room.. WELCOME TO PLAY HAVEN! WE ARE A TEACHER-CREATED PLAY SPACE AND PARTY VENUE FOR INFANTS, TODDLERS, AND PRESCHOOLERS WHERE CHILDREN AND. Play Haven was created by a preschool teacher of 12 years. We offer activities that promote early childhood learning, social and emotional development, and fine motor skills. Here you will find everything from art and sensory activities, to imaginative games and dramatic Always a new experience, and always fun! Find a play option that works best for you. Hosting a birthday party? Plan your next event at Play Haven and let us handle the rest. Play Haven is San Francisco’s newest indoor learn & play center, where children and families come together to explore, create, and have Our mission is to provide an inspiring space for imaginative play that promotes social and emotional development, and serves as a gathering Here you will find everything from art and sensory activities, to imaginative games and dramatic play areas, and even a rock climbing Thank you! We will keep you posted on our news and specials at Play Haven.


Playhavensf Main Page Content

HTML Tag Content Informative?
Title: Play Haven SF - Children's Play Space & Party Could be improved
Description: Play Haven is San Francisco's newest indoor play space and learning center. Here you will find everything from art and sensory activities, to imaginative games and dramatic play areas, and even a rock climbing wall. We will also offer private parties for birthdays, a variety of children's
H1: WelcomeIs it informative enough?
H3: PlayIs it informative enough?

Other Helpful Websites and Services for Playhavensf

Internal Pages

/play/:
Title

Play — Play Haven

Description

Visit us at Play Haven. Here's how.

H2

We have two convenient play options:

All the information about playhavensf.com was collected from publicly available sources

Similar domain names

playhavenvilas.complayhavruta.scienceplayhawk.lifeplayhavencentraltoyswonderland.complayhaven.complayhaveandkeep.com



CAPTCHA ERROR
Recent Comments
Ronald Kurtz about trimbodymax.com
You took 89.95 and 84.95 at the same time from my back account that i didnt authorize and was apparently hacked. I...
Ester Joseph about repassists.com
Please refund my money back I never knew this am not interested
Jose Chavez about spoosk.com
Ive been charged for no reason this is fraud and want my money back!
CHANTREA BO about sitetaskreps.com
Good morning, Can you tell me what i have been charged for on 10/8/19 amount of $61..90 I believe this could be...
Leo Wickers IV about dotabon.com
Stop charging my account or police and better business bureau will be notified
tangi muzzo about attrdte.com
I need the money tht you took from my account.. I have no idea of what this site is all about.. Please return my...
Mthetheleli Peter about feemyd.com
This is a fraud I want my money back
motonobu matsubara about talentbrainstore.com
Please refund my 100yen and 10,000yen you took fraudulently as I never purchased or joined your site. Please cancel...
Selwyn Clarke about cartplay.com
Hi I sent an e-mail to you Thursday (nz) time and as yet I have had no response the number referred to is...
Nicolash Fernandes about ddos-guard.net
Knowing how reliable and secure DDoS protection service from ddos-guard.net, I have updated my plan with them and...
John about webtermdata.com
You have charged my credit card for $54.56 please add it back and cancel my subscription card ending 6485
DMCA.com Protection Status