Playhavensf.com receives about 2726 visitors in one month. That could possibly earn $13.63 each month or $0.45 each day. Server of the website is located in the United States. Playhavensf.com main page was reached and loaded in 0.44 seconds. This is a good result. Try the services listed at the bottom of the page to search for available improvements.
Is playhavensf.com legit? | |
Website Value | $246 |
Alexa Rank | 1716562 |
Monthly Visits | 2726 |
Daily Visits | 91 |
Monthly Earnings | $13.63 |
Daily Earnings | $0.45 |
Country: United States
Metropolitan Area: New York
Postal Reference Code: 10013
Latitude: 40.7157
Longitude: -74
HTML Tag | Content | Informative? |
---|---|---|
Title: | Play Haven SF - Children's Play Space & Party | Could be improved |
Description: | Play Haven is San Francisco's newest indoor play space and learning center. Here you will find everything from art and sensory activities, to imaginative games and dramatic play areas, and even a rock climbing wall. We will also offer private parties for birthdays, a variety of children's | |
H1: | Welcome | Is it informative enough? |
H3: | Play | Is it informative enough? |
Results will appear here |
|
Pingdom - Web transfer-speed test from Pingdom
Run diagnostic transfer-rate tests on each page or individual page components (JS, .img, and HTML code) with Pingdom for playhavensf.com
Google’s Web Analytics Google provides many analytical tools for the web that will help you find out the number of visitors, their locations and activities when logging onto playhavensf.com
Alexa - playhavensf.com on Alexa Traffic Rank Data
Alexa provides a charting service that shows global position by audience, engagement, and time spent on playhavensf.com
Majestic Backlinks - Lookup other webpages that have hyperlinks leading to playhavensf.com.
Google Index - Which of the pages is Google.com indexing?
Find out which pages from playhavensf.com have made it into Google.com’s listings. You can find out with the "site:" query.
Website on this IP by Bing - All sites on the same 198.185.159.144 IP
View a list of websites with an IP matching that of playhavensf.com from Bing.com
/play/: | |
---|---|
Title |
Play — Play Haven |
Description |
Visit us at Play Haven. Here's how. |
H2 |
We have two convenient play options: |
Similar domain names
playhavenvilas.complayhavruta.scienceplayhawk.lifeplayhavencentraltoyswonderland.complayhaven.complayhaveandkeep.com
You took 89.95 and 84.95 at the same time from my back account that i didnt authorize and was apparently hacked. I...