Playhearts-online.com Website Review


Make info private

Traffic and Value

Is playhearts-online.com legit?
Website Value $11089
Alexa Rank 621453
Monthly Visits 123205
Daily Visits 4107
Monthly Earnings $616.03
Daily Earnings $20.53
Click Here for Full Review

Playhearts-online.com Server Location

Country: United States
Metropolitan Area: Not defined
Postal Reference Code: Not defined
Latitude: 37.751
Longitude: -97.822




Summarized Content

Is your Queen of Spades. It offers 1 3 penalty points to you! This is actually a game in which you want a score rather than high. Normally it is best to pas* on your three worst cards to test and eliminate them. The competitor which you pas* to fluctuates (we'll handle that part for you), you start by pas*ing into the competition on your left. Afterward, while within the game you pas* into your competitor on the right. For the 3rd match you pas* through the dining table and also in the match you do not pas* any and keep your cards. Lawsuit must be played. If not, they are able to play any one of these other cards. Once 4 cards have been played, the player who played with with the highest rank card takes the trick. This means he or she takes the 4 cards onto the table and then starts the turn. Any penalty cards (any hearts or queen of spades) the key would be inserted into the player's punishment rating. Try to steer clear of these until you're shooting the moon which we'll wind hearts have been played to date, you can't select a heart as the card to playwith. In this variant you can always play the queen of spades and hearts doesn't break, although until hearts was busted in a few versions of game Hearts you can not play the Queen of Spades. hand. The match is finished when one of these players reaches 100 points then, and also the player with minimum number of points will be the winner. You can find more equal with the points or 2 and if things are over 100 then play will continue until there's only one you. In the event you receive all of the charge cards (thirte*n hearts and the Queen of Spades) you then get zero points along with the rest of the players get 26 points each. Trying this is sometimes a somewhat risky move, as if another player gets one among the hearts you will end up with plenty of points. Alright, now that we've we have that down let us play a few Hearts! We've got a lot of other games to play if you get bored here! Maybe go play the card game Rummy or even the play the card game Spades. . Both complimentary


Playhearts-online Main Page Content

HTML Tag Content Informative?
Title: HEARTS! | Play Online, Could be improved
Description: Not set Empty
H1: HeartsIs it informative enough?
H2: Rules of HeartsIs it informative enough?

Other Helpful Websites and Services for Playhearts-online

All the information about playhearts-online.com was collected from publicly available sources

Similar domain names

playheartscardgame.reviewplayheartsstudio.complayheartstone.complayheartonline.winplayheartmusic.complayheartlandslots.org



CAPTCHA ERROR
Recent Comments
Ronald Kurtz about trimbodymax.com
You took 89.95 and 84.95 at the same time from my back account that i didnt authorize and was apparently hacked. I...
Ester Joseph about repassists.com
Please refund my money back I never knew this am not interested
Jose Chavez about spoosk.com
Ive been charged for no reason this is fraud and want my money back!
CHANTREA BO about sitetaskreps.com
Good morning, Can you tell me what i have been charged for on 10/8/19 amount of $61..90 I believe this could be...
Leo Wickers IV about dotabon.com
Stop charging my account or police and better business bureau will be notified
tangi muzzo about attrdte.com
I need the money tht you took from my account.. I have no idea of what this site is all about.. Please return my...
Mthetheleli Peter about feemyd.com
This is a fraud I want my money back
motonobu matsubara about talentbrainstore.com
Please refund my 100yen and 10,000yen you took fraudulently as I never purchased or joined your site. Please cancel...
Selwyn Clarke about cartplay.com
Hi I sent an e-mail to you Thursday (nz) time and as yet I have had no response the number referred to is...
Nicolash Fernandes about ddos-guard.net
Knowing how reliable and secure DDoS protection service from ddos-guard.net, I have updated my plan with them and...
John about webtermdata.com
You have charged my credit card for $54.56 please add it back and cancel my subscription card ending 6485
DMCA.com Protection Status