Seattlegasprices.com receives about 1457 visitors in one month. That could possibly earn $7.29 each month or $0.24 each day. Server of the website is located in the United States. Seattlegasprices.com main page was reached and loaded in 0.51 seconds. This is a good result. Try the services listed at the bottom of the page to search for available improvements.
Is seattlegasprices.com legit? | |
Website Value | $132 |
Alexa Rank | 2561382 |
Monthly Visits | 1457 |
Daily Visits | 49 |
Monthly Earnings | $7.29 |
Daily Earnings | $0.24 |
Country: United States
Metropolitan Area: Not defined
Postal Reference Code: Not defined
Latitude: 37.751
Longitude: -97.822
HTML Tag | Content | Informative? |
---|---|---|
Title: | Seattle Gas Prices - Find Cheap Gas Prices in | Could be improved |
Description: | Search for cheap gas prices in Seattle, Washington; find local Seattle gas prices & gas stations with the best fuel | ![]() |
H1: | How does GasBuddy Work? | Is it informative enough? |
H2: | 3.374 | Is it informative enough? |
Results will appear here |
|
Pingdom - Web transfer-speed test from Pingdom
Run diagnostic transfer-rate tests on each page or individual page components (JS, .img, and HTML code) with Pingdom for seattlegasprices.com
Google’s Web Analytics Google provides many analytical tools for the web that will help you find out the number of visitors, their locations and activities when logging onto seattlegasprices.com
Alexa - seattlegasprices.com on Alexa Traffic Rank Data
Alexa provides a charting service that shows global position by audience, engagement, and time spent on seattlegasprices.com
Majestic Backlinks - Lookup other webpages that have hyperlinks leading to seattlegasprices.com.
Google Index - Which of the pages is Google.com indexing?
Find out which pages from seattlegasprices.com have made it into Google.com’s listings. You can find out with the "site:" query.
Website on this IP by Bing - All sites on the same 2606:4700::6812:a84 IP
View a list of websites with an IP matching that of seattlegasprices.com from Bing.com
/index.aspx: | |
---|---|
Title |
Seattle Gas Prices - Find Cheap Gas Prices in Washington |
Description |
Search for cheap gas prices in Seattle, Washington; find local Seattle gas prices & gas stations with the best fuel prices. |
H1 |
How does GasBuddy Work? |
/GasPriceSearch.aspx: | |
---|---|
Title |
Seattle Gas Prices - Find Cheap Gas Prices in Washington |
Description |
Not defined |
H1 |
How does GasBuddy Work? |
/Prize_Give_Away.aspx: | |
---|---|
Title |
Prize Give-Away Information - Seattle Gas Prices |
Description |
Not defined |
H1 |
GasBuddy Prize Give-Away Winners |
/Prices_Nationally.aspx: | |
---|---|
Title |
Average Prices By State - Seattle Gas Prices |
Description |
Not defined |
H1 |
Show Average Prices By Metro Area |
/TripCalculator.aspx: | |
---|---|
Title |
Seattle Gas Prices - Trip Cost Calculator - Maximize Your Fuel Savings |
Description |
Not defined |
H1 |
Trip Cost Calculator |
Similar domain names
snapcheat1.comupdate-manualseattlegastricbypassdoctor.comseattlegatewaycenter.comseattlegay.lifeseattlegasapplianceservice.comseattlegargedoors.netseattlegargedoors.info
You took 89.95 and 84.95 at the same time from my back account that i didnt authorize and was apparently hacked. I...