Skillspro.co.za Website Review


Make info private

Traffic and Value

Is skillspro.co.za legit?
Website Value $844
Alexa Rank 803692
Monthly Visits 9370
Daily Visits 313
Monthly Earnings $46.85
Daily Earnings $1.56
Click Here for Full Review

Skillspro.co.za Server Location

Country: South Africa
Metropolitan Area: Not defined
Postal Reference Code: Not defined
Latitude: -29
Longitude: 24




Summarized Content

contact us for more info on future-fun caps content and as*essments e-publications. nelson mandela, we will continue your legacy and bless the futurekiddies of south africa. future-fun caps want to thank you for all the positive feedback regarding our annual national as*essment e-learning preparations for we have been overwhelmed with requests to add the 2014 ana e-learning preparation as well this year for maths, english and afrikaans. now available to order: colourful ana ebooks per grade, featuring our own future-fun caps characters, based on the ana exams 2012, 2013 and please send email to [email protected] for more info and the ana orderform. don’t miss out to order your ana ebook preparations per. future-fun caps as an innovative technology tool to a teacher to make more time available to teach and facilitate learning. this is a caps. aligned innovative, e-publication with videos, songs, presentations, flash content, self-testing content with high quality sound and. picture that keeps learners interested, participating and engaged in every lesson. future-fun caps will increase the pas* rate on ana. results and integrate technology into every subject in primary schools. our long term goal is to give all learners a chance to learn. our company comprises education specialists, training experts, partners and directors  who are de*ply committed to education.  as a. this exciting new integrated series has been developed to as*ist teachers.  it provides the teacher with an e-book that contains a. lesson plan and media resources that are fully aligned and integrated with caps..     contact us now for 15 free samples of  future-fun caps. by staying at the cutting edge of technological and educational trends, the skillspro group will remain the leading supplier of integrated ict solutions to the educational institutions of southern africa, sub-saharan africa and europe empowering learners and educators with the most appropriate software and skills.


Skillspro Main Page Content

HTML Tag Content Informative?
Title: Could be improved
Description: Not set Empty
H1: Nelson Mandela, we will continue your legacy and bless the Futurekiddies of South Africa

Other Helpful Websites and Services for Skillspro

All the information about skillspro.co.za was collected from publicly available sources

Similar domain names

snapcheat1.comupdate-manualskillspro.netskillspro.spaceskillsprod.comskillsprivateacademy.netskillsprivateacademy.comskillspringcommunications.com



CAPTCHA ERROR
Recent Comments
Ronald Kurtz about trimbodymax.com
You took 89.95 and 84.95 at the same time from my back account that i didnt authorize and was apparently hacked. I...
Ester Joseph about repassists.com
Please refund my money back I never knew this am not interested
Jose Chavez about spoosk.com
Ive been charged for no reason this is fraud and want my money back!
CHANTREA BO about sitetaskreps.com
Good morning, Can you tell me what i have been charged for on 10/8/19 amount of $61..90 I believe this could be...
Leo Wickers IV about dotabon.com
Stop charging my account or police and better business bureau will be notified
tangi muzzo about attrdte.com
I need the money tht you took from my account.. I have no idea of what this site is all about.. Please return my...
Mthetheleli Peter about feemyd.com
This is a fraud I want my money back
motonobu matsubara about talentbrainstore.com
Please refund my 100yen and 10,000yen you took fraudulently as I never purchased or joined your site. Please cancel...
Selwyn Clarke about cartplay.com
Hi I sent an e-mail to you Thursday (nz) time and as yet I have had no response the number referred to is...
Nicolash Fernandes about ddos-guard.net
Knowing how reliable and secure DDoS protection service from ddos-guard.net, I have updated my plan with them and...
John about webtermdata.com
You have charged my credit card for $54.56 please add it back and cancel my subscription card ending 6485
DMCA.com Protection Status