Srisriravishankar.org Website Review


Make info private

Traffic and Value

Is srisriravishankar.org legit?
Website Value $8276
Alexa Rank 339360
Monthly Visits 91951
Daily Visits 3066
Monthly Earnings $459.76
Daily Earnings $15.33
Click Here for Full Review


Srisriravishankar.org Server Location

Country: Ireland
Metropolitan Area: Dublin
Postal Reference Code: D02
Latitude: 53.3338
Longitude: -6.2488




Summarized Content

gave degrees to graduating students and received an honorary doctorate at karnavati university, gandhinagar. two main muslim petitioners, haji mehboob and mohammad umar have signed a statement calling for an out of court settlement… over 150 officials of the central bureau of investigation (cbi) participated in the art of living program. for the first time in northeast india, 67 groups of various ideologies, many of whom had taken to militancy, have come together taking the call for peace to the middle of the conflict zone, gurudev visited erbil in kurdistan, the violence hit province of iraq on a warm reception at the royal palace in al rumailah by sheikh hamad bin mohammed al sharqi, supreme council member and ruler of fujairah and the members of the royal family, the emirates. gurudev is on a four day visit to uae on a special invite by the ruler of fujairah.. sri sri ravi shankar demystifies yoga for the european parliament, calls it the need of the hour. depression is a significant problem and yoga can help people come out of depression and heal this - let’s wish for the world to be a. international women’s conference - enabling influential women leaders through spirituality and wisdom. with women from 60 countries including 250 delegates, 100 rural women, 60 students from over 30 colleges, the conference set the tone for open discussions about critical issues faced by women in positions of leadership and influence and how spirituality provides key tools for over a lakh people from 6 continents and 75 countries join mahashivratri celebrations with gurudev sri sri ravi shankar february 13, 2018 bengaluru, india meditations, accompanied by vibrations of ancient chants, the sound of cymbals, drums and devotional music filled the air at the pristine, colorful, and lit-up art of living international center as over one lakh devotees from 75 countries gathered to celebrate the occasion of mahashivratri.“since thousands of years, people have experienced..


Srisriravishankar Main Page Content

HTML Tag Content Informative?
Title: Gurudev Sri Sri Ravi Shankar | Official Could be improved
Description: Gurudev Sri Sri Ravi Shankar is a humanitarian, spiritual leader and an ambassador of peace. He is the founder of the Art of Living Foundation which, through its various service projects promotes yoga, meditation and powerful breathing techniques including the Sudarshan Kriya for betterment of the
H1: Official Website of Sri Sri Ravi Shankar "My Vision is a Stress-Free, Violence-Free World"
H2: Convocation at Karnavati UniversityIs it informative enough?
H3: Looking for Art of Living Programs?Is it informative enough?

Other Helpful Websites and Services for Srisriravishankar

Internal Pages

/comments/feed/:
Title

Comments for Official Website of Sri Sri Ravi Shankar

Description

Not defined

/work-entry/ayodhya-two-main-petitioners-support-out-of-court-settlement/:
Title

Ayodhya: Two main Muslim petitioners support out-of-court settlement | Official Website of Sri Sri Ravi Shankar

Description

Main Muslim petitioners, Haji Mehboob and Mohammad Umar have signed a statement calling for an out of court settlement. The Imam of Kevda Masjid, Ayodhya, and

H1

Official Website of Sri Sri Ravi Shankar "My Vision is a Stress-Free, Violence-Free World"

H2

Ayodhya: Two main Muslim petitioners support out-of-court settlement

H3

Related News –

/work-entry/the-central-bureau-of-investigation-cbi-of-india-experiences-the-art-of-living/:
Title

The Central Bureau of Investigation (CBI) of India experiences the Art of Living | Official Website of Sri Sri Ravi Shankar

Description

Over 150 officials of the Central Bureau of Investigation (CBI) participated in the Art of Living program.

H1

Official Website of Sri Sri Ravi Shankar "My Vision is a Stress-Free, Violence-Free World"

H2

The Central Bureau of Investigation (CBI) of India experiences the Art of Living

H3

Some testimonials shared by the participants –

/work-entry/strength-diversity-north-east-indigenous-peoples-conference/:
Title

Strength in Diversity: North East Indigenous People's Conference | Official Website of Sri Sri Ravi Shankar

Description

The day long deliberations at the Conference ended with the signing of the Guwahati Declaration to achieve the ultimate goal of genuine peace, prosperity and

H1

Official Website of Sri Sri Ravi Shankar "My Vision is a Stress-Free, Violence-Free World"

H2

Strength in Diversity: North East Indigenous People’s Conference

H3

Looking for Art of Living Programs?

/work-entry/sri-sri-ventures-into-conflict-zone-to-pitch-for-peace-in-iraq/:
Title

Sri Sri ventures into conflict zone to pitch for peace in Iraq | Official Website of Sri Sri Ravi Shankar

Description

Taking the call for peace to the middle of the conflict zone, renowned spiritual leader and founder of The Art of Living, Sri Sri Ravi Shankar addressed a peace

H1

Official Website of Sri Sri Ravi Shankar "My Vision is a Stress-Free, Violence-Free World"

H2

Sri Sri ventures into conflict zone to pitch for peace in Iraq

H3

Looking for Art of Living Programs?

All the information about srisriravishankar.org was collected from publicly available sources

Similar domain names

snapcheat1.comupdate-manualsrisrirealestate.comsrisrirealty.comsrisriresidency.comsrisriravishankar.newssrisriproperties.comsrisriproductsglobal.com



CAPTCHA ERROR
Recent Comments
Ronald Kurtz about trimbodymax.com
You took 89.95 and 84.95 at the same time from my back account that i didnt authorize and was apparently hacked. I...
Ester Joseph about repassists.com
Please refund my money back I never knew this am not interested
Jose Chavez about spoosk.com
Ive been charged for no reason this is fraud and want my money back!
CHANTREA BO about sitetaskreps.com
Good morning, Can you tell me what i have been charged for on 10/8/19 amount of $61..90 I believe this could be...
Leo Wickers IV about dotabon.com
Stop charging my account or police and better business bureau will be notified
tangi muzzo about attrdte.com
I need the money tht you took from my account.. I have no idea of what this site is all about.. Please return my...
Mthetheleli Peter about feemyd.com
This is a fraud I want my money back
motonobu matsubara about talentbrainstore.com
Please refund my 100yen and 10,000yen you took fraudulently as I never purchased or joined your site. Please cancel...
Selwyn Clarke about cartplay.com
Hi I sent an e-mail to you Thursday (nz) time and as yet I have had no response the number referred to is...
Nicolash Fernandes about ddos-guard.net
Knowing how reliable and secure DDoS protection service from ddos-guard.net, I have updated my plan with them and...
John about webtermdata.com
You have charged my credit card for $54.56 please add it back and cancel my subscription card ending 6485
DMCA.com Protection Status