Takeapen.org Website Review


Make info private

Traffic and Value

Is takeapen.org legit?
Website Value $71
Alexa Rank 4657563
Monthly Visits 778
Daily Visits 26
Monthly Earnings $3.89
Daily Earnings $0.13
Click Here for Full Review

Takeapen.org Server Location

Country: Israel
Metropolitan Area: Ramat HaSharon
Postal Reference Code: Not defined
Latitude: 32.1472
Longitude: 34.8417




Summarized Content

foes: hamas leaders tried for war crimes! - friends: italian philosemitism!. giro d'italia in israel! and the italia-israel friendship. it has been a wonderful 3 days long big-start of giro d’italia in israel: 177 top cyclists  of the world in their colorful shirts swarmed in jeru-salem, haifa, tel-aviv and the last 227 km to eilat, through amazing desert landscapes. on the 2nd day i stayed in caesarea, since the tel aviv main road was closed due to giro, and took photo of a  list of old-established with a recently published book: ki szereti a zsidokat? a magyar filoszemitizmus - (who likes the jews? hungarian philosemitism) research continues into past and present better austro-hungarian, czech, italian, german  and other coexistance, or philosemitism. - see more on the website: www.philosemitism.com        . foes: daesh (isis) and hamas are parts of the same global terror threat. hamas leaders must be tried for war crimes! this takeapen petition, with 50,000 signatures from 80 countries, demands to prosecute hamas leaders for their war crimes: targeting israeli civilians; using gazan civilians including children as human shields.. among the recent signatures there are from usa, france, canada, spain and germany, but also from india, russia, south korea, south. our similar petition in 2009 (see in campaigns for israel) was the first ever in the world, got 90,000 signatures, and is still on top of google searches.  this present takeapenglobal petition is #1 for its legal proficiency. our first goal is to educate the world about hamas war crimes. isis-daesh and hamas are the same threat!  please sign!   - secretary-general mr ban ki-moon, - the president of of united nations security council, and - mrs. fatou bensouda, prosecutor of the international criminal court. subject: hamas leaders must be tried for war crimes and crimes against humanity they have committed. your excellencies! we, the undersigned to this petition and millions more around the world, expect the un’s decisive action against hamas


Takeapen Main Page Content

HTML Tag Content Informative?
Title: The Truth About Israel | Take A Could be improved
Description: The truth about Israel in 19 languages. Click for information about Israel and the Middle East
H1: FOES: Hamas Leaders Tried for War Crimes! - FRIENDS: ITALIAN Philosemitism!
H2: Israel did not kill M. Al-Dura!!! Is it informative enough?

Other Helpful Websites and Services for Takeapen

Internal Pages

/Takeapen/Templates/ShowPage.asp?DBID=1&LNGID=1&TMID=84&FID=484:
Title

The Truth About Israel | Take A Pen

Description

The truth about Israel in 19 languages. Click for information about Israel and the Middle East conflict.

H1

FOES: Hamas Leaders Tried for War Crimes! - FRIENDS: ITALIAN Philosemitism!

H2

Israel did not kill M. Al-Dura!!! 

All the information about takeapen.org was collected from publicly available sources

Similar domain names

takeapenny-leaveapenny.comtakeapenny.comtakeapennyleaveapenny.nettakeapeektours.comtakeapeektarot.comtakeapeekreviews.com



CAPTCHA ERROR
Recent Comments
Ronald Kurtz about trimbodymax.com
You took 89.95 and 84.95 at the same time from my back account that i didnt authorize and was apparently hacked. I...
Ester Joseph about repassists.com
Please refund my money back I never knew this am not interested
Jose Chavez about spoosk.com
Ive been charged for no reason this is fraud and want my money back!
CHANTREA BO about sitetaskreps.com
Good morning, Can you tell me what i have been charged for on 10/8/19 amount of $61..90 I believe this could be...
Leo Wickers IV about dotabon.com
Stop charging my account or police and better business bureau will be notified
tangi muzzo about attrdte.com
I need the money tht you took from my account.. I have no idea of what this site is all about.. Please return my...
Mthetheleli Peter about feemyd.com
This is a fraud I want my money back
motonobu matsubara about talentbrainstore.com
Please refund my 100yen and 10,000yen you took fraudulently as I never purchased or joined your site. Please cancel...
Selwyn Clarke about cartplay.com
Hi I sent an e-mail to you Thursday (nz) time and as yet I have had no response the number referred to is...
Nicolash Fernandes about ddos-guard.net
Knowing how reliable and secure DDoS protection service from ddos-guard.net, I have updated my plan with them and...
John about webtermdata.com
You have charged my credit card for $54.56 please add it back and cancel my subscription card ending 6485
DMCA.com Protection Status