Tastyvapor.us receives about 24167 visitors in one month. That could possibly earn $120.84 each month or $4.03 each day. Server of the website is located in the United States. Tastyvapor.us main page was reached and loaded in 0.92 seconds. This is a good result. Try the services listed at the bottom of the page to search for available improvements.
Traffic and Value
| Is tastyvapor.us legit? | |
| Website Value | $2176 |
| Alexa Rank | 313946 |
| Monthly Visits | 24167 |
| Daily Visits | 806 |
| Monthly Earnings | $120.84 |
| Daily Earnings | $4.03 |
Tastyvapor.us Server Location
Country: United States
Metropolitan Area: Not defined
Postal Reference Code: Not defined
Latitude: 37.751
Longitude: -97.822
Summarized Content
Tastyvapor Main Page Content
| HTML Tag | Content | Informative? |
|---|---|---|
| Title: | Tasty Vapor E-Juice - Custom Made | Could be improved |
| Description: | Tasty Vapor is the leading manufacturer of highest quality custom made eliquids. Our e-juice is hand-mixed, 100% USA made and always guaranteed to taste |  |
| H2: | Categories | Is it informative enough? |
| H3: | To satisfy all vapor connoisseurs by providing the most consistent, premium quality E-Liquids on the market today. Inspired by pastry chefs and create | |
We've noticed that you have issues with some content elements on the main page:
• Title contains 42 characters. We think that you could improve this tag by adding more relevant information or keywords.
• Take a look at the headings; there might be too little information. Headings are important for usability and search engine optimization.
Other Helpful Websites and Services for Tastyvapor
Results will appear here |
|
Pingdom - Web transfer-speed test from Pingdom
Run diagnostic transfer-rate tests on each page or individual page components (JS, .img, and HTML code) with Pingdom for tastyvapor.us
Google’s Web Analytics Google provides many analytical tools for the web that will help you find out the number of visitors, their locations and activities when logging onto tastyvapor.us
Alexa - tastyvapor.us on Alexa Traffic Rank Data
Alexa provides a charting service that shows global position by audience, engagement, and time spent on tastyvapor.us
Majestic Backlinks - Lookup other webpages that have hyperlinks leading to tastyvapor.us.
Google Index - Which of the pages is Google.com indexing?
Find out which pages from tastyvapor.us have made it into Google.com’s listings. You can find out with the "site:" query.
Website on this IP by Bing - All sites on the same 104.195.64.149 IP
View a list of websites with an IP matching that of tastyvapor.us from Bing.com
Internal Pages
| /cart.php: | |
|---|---|
| Title |
Tasty Vapor - Shopping Cart |
| Description |
Tasty Vapor is the leading manufacturer of highest quality custom made eliquids. Our e-juice is hand-mixed, 100% USA made and always guaranteed to taste fresh |
| H1 |
Your Shopping Cart |
| H2 |
Categories |
| H3 |
Coupon Code |
| /account.php: | |
|---|---|
| Title |
Tasty Vapor - Sign in |
| Description |
Tasty Vapor is the leading manufacturer of highest quality custom made eliquids. Our e-juice is hand-mixed, 100% USA made and always guaranteed to taste fresh |
| H1 |
Sign in or Create Account |
| H2 |
Categories |
| H3 |
Create a New Account |
| /specials/: | |
|---|---|
| Title |
Special Deals on Nicotine Liquids - Tasty Vapor |
| Description |
Shop special deals on TastyVapor's Nicotine Liquids line. All e-liquids are highly customizable! |
| H1 |
Specials |
| H2 |
Categories |
Similar domain names
tastyvega.comtastyvegan.lifetastyvegan.sitetastyvapez.comtastyvapeshop.comtastyvapes.store
Good morning, Can you tell me what i have been charged for on 10/8/19 amount of $61..90 I believe this could be...
Stop charging my account or police and better business bureau will be notified
I need the money tht you took from my account.. I have no idea of what this site is all about.. Please return my...
Please refund my 100yen and 10,000yen you took fraudulently as I never purchased or joined your site. Please cancel...
Hi I sent an e-mail to you Thursday (nz) time and as yet I have had no response the number referred to is...
Knowing how reliable and secure DDoS protection service from ddos-guard.net, I have updated my plan with them and...
You have charged my credit card for $54.56 please add it back and cancel my subscription card ending 6485
You took 89.95 and 84.95 at the same time from my back account that i didnt authorize and was apparently hacked. I...