Thepenslave.com receives about 617 visitors in one month. That could possibly earn $3.09 each month or $0.1 each day. Server of the website is located in India. It took our server 2.36 seconds to reach and load the main page of Thepenslave.com. This does not include JavaScript, image and CSS files load timing. This is a good result. This result is good enough, but there is a room for improvement. If you would like to investigate please refer to the link at the bottom of this page.
Is thepenslave.com legit? | |
Website Value | $56 |
Alexa Rank | 4788748 |
Monthly Visits | 617 |
Daily Visits | 21 |
Monthly Earnings | $3.09 |
Daily Earnings | $0.1 |
Country: India
Metropolitan Area: Mumbai
Postal Reference Code: 400072
Latitude: 19.0728
Longitude: 72.8826
HTML Tag | Content | Informative? |
---|---|---|
Title: | The Pen Ink your | Could be improved |
Description: | Ink your | Could be improved |
H1: | The Pen | Is it informative enough? |
H2: | Posts | Is it informative enough? |
H3: | Is it informative enough? |
Results will appear here |
|
Pingdom - Web transfer-speed test from Pingdom
Run diagnostic transfer-rate tests on each page or individual page components (JS, .img, and HTML code) with Pingdom for thepenslave.com
Google’s Web Analytics Google provides many analytical tools for the web that will help you find out the number of visitors, their locations and activities when logging onto thepenslave.com
Alexa - thepenslave.com on Alexa Traffic Rank Data
Alexa provides a charting service that shows global position by audience, engagement, and time spent on thepenslave.com
Majestic Backlinks - Lookup other webpages that have hyperlinks leading to thepenslave.com.
Google Index - Which of the pages is Google.com indexing?
Find out which pages from thepenslave.com have made it into Google.com’s listings. You can find out with the "site:" query.
Website on this IP by Bing - All sites on the same 103.21.59.165 IP
View a list of websites with an IP matching that of thepenslave.com from Bing.com
Similar domain names
thepenslinger.comthepensmiths.comthepensmithshoppe.comthepenskefile.netthepensivetraveller.kimthepensivescribbler.com
You took 89.95 and 84.95 at the same time from my back account that i didnt authorize and was apparently hacked. I...