Trackmytarget.com receives about 3656 visitors in one month. That could possibly earn $18.28 each month or $0.61 each day. Server of the website is located in Ireland. Trackmytarget.com main page was reached and loaded in 0.48 seconds. This is a good result. Try the services listed at the bottom of the page to search for available improvements.
Is trackmytarget.com legit? | |
Website Value | $330 |
Alexa Rank | 1282794 |
Monthly Visits | 3656 |
Daily Visits | 122 |
Monthly Earnings | $18.28 |
Daily Earnings | $0.61 |
Country: Ireland
Metropolitan Area: Dublin
Postal Reference Code: D02
Latitude: 53.3338
Longitude: -6.2488
HTML Tag | Content | Informative? |
---|---|---|
Title: | Target Circle: Online & Mobile Performance Marketing | Could be improved |
Description: | Target Circle matches traffic supply and demand in a revolutionary | Could be improved |
H1: | Your own advertising technology, Made for scaling performance. | |
H2: | Ready to get started? | Is it informative enough? |
H3: | Get in touch or start monetising. | Is it informative enough? |
Results will appear here |
|
Pingdom - Web transfer-speed test from Pingdom
Run diagnostic transfer-rate tests on each page or individual page components (JS, .img, and HTML code) with Pingdom for trackmytarget.com
Google’s Web Analytics Google provides many analytical tools for the web that will help you find out the number of visitors, their locations and activities when logging onto trackmytarget.com
Alexa - trackmytarget.com on Alexa Traffic Rank Data
Alexa provides a charting service that shows global position by audience, engagement, and time spent on trackmytarget.com
Majestic Backlinks - Lookup other webpages that have hyperlinks leading to trackmytarget.com.
Google Index - Which of the pages is Google.com indexing?
Find out which pages from trackmytarget.com have made it into Google.com’s listings. You can find out with the "site:" query.
Website on this IP by Bing - All sites on the same 52.211.91.137 IP
View a list of websites with an IP matching that of trackmytarget.com from Bing.com
/en/home/: | |
---|---|
Title |
Target Circle: Online & Mobile Performance Marketing Software |
Description |
Target Circle matches traffic supply and demand in a revolutionary way. |
H1 |
Your own advertising technology, Made for scaling performance. |
H2 |
Ready to get started? |
H3 |
Get in touch or start monetising. |
/en/careers/: | |
---|---|
Title |
Careers |
Description |
Target Circle matches traffic supply and demand in a revolutionary way. |
H1 |
We've come far. With your help we’ll go further. |
H2 |
Work on hard problems |
/en/pricing/: | |
---|---|
Title |
Pricing |
Description |
Target Circle matches traffic supply and demand in a revolutionary way. |
H1 |
Unlimited impressions, clicks, offers, publishers and users. Pay only for approved transactions. |
H2 |
Ready to get started? |
H3 |
[[ selectedMobilePlan.plan | uppercase ]] |
/en/contact/: | |
---|---|
Title |
Contact Target Circle by phone or email |
Description |
Target Circle matches traffic supply and demand in a revolutionary way. |
H1 |
Get in touch and let us know how we can help |
H3 |
Headquarters |
Similar domain names
trackmytask.infotrackmytax.infotrackmytaxrefund.comtrackmytail.nettrackmyswing.nettrackmyswimmingpool.com
You took 89.95 and 84.95 at the same time from my back account that i didnt authorize and was apparently hacked. I...