Wakefieldexpress.co.uk Website Review


Make info private

Traffic and Value

Is wakefieldexpress.co.uk legit?
Website Value $14144
Alexa Rank 649663
Monthly Visits 157154
Daily Visits 5239
Monthly Earnings $785.77
Daily Earnings $26.19
Click Here for Full Review


Wakefieldexpress.co.uk Server Location

Country: United States
Metropolitan Area: Not defined
Postal Reference Code: Not defined
Latitude: 37.751
Longitude: -97.822




Summarized Content

the abc murders: agatha christie mystery filmed in yorkshire to be shown on bbc at christmas. five bus stops on single road 'mindlessly vandalised' in boxing day rampage. wakefield eastern relief road cuts rush hour journey times by 12 minutes, authority claims. more than 600 an*mals counted and measured in yorkshire wildlife park audit. new high streets fund will help ‘drive change’ in yorkshire’s towns. peter smith’s verdict: leeds rhinos leave it late to give david furner a winning start. chris chester excited by wakefield trinity’s first run out at leeds rhinos. leeds rhinos 10 wakefield trinity 4: rhinos hit back to retain festive challenge honours. leeds united: roofe crowns amazing injury-time comeback against blackburn. leeds rhinos v wakefield trinity: chester’s men ready to test themselves at headingley. people in west yorkshire are least likely to eat turkey, as new trends transform the typical christmas day. people in west yorkshire are least likely to eat turkey, as new trends transform the typical christmas day. city tastes & tipples: the wakefield cafe that is helping to turn lives around. this is what prisoners in yorkshire jails will be eating for christmas dinner. five bus stops on single road 'mindlessly vandalised' in boxing day rampage. gi*l, 6, suffers facial injuries after being hit by cyclist outside primary school.


Wakefieldexpress Main Page Content

HTML Tag Content Informative?
Title: Wakefield Could be improved
Description: A Wakefield perspective on news, sport, what's on, lifestyle and more, from your local paper the Wakefield
H1: Wakefield ExpressIs it informative enough?
H2: Sport More Sport >>Is it informative enough?
H3: Vehicle fire on M62 motorway in West YorkshireIs it informative enough?

Other Helpful Websites and Services for Wakefieldexpress

Internal Pages

/jobs:
Title

Search for local jobs in Wakefield | Wakefield Express

Description

Search and apply for local jobs in Wakefield today

H1

Looking for jobs in Wakefield, West Yorkshire?

H2

Recruiting in Wakefield?

H3

Follow Us On

/cars:
Title

Used Cars for sale, car news and reviews

Description

Car news reviews and articles and cl ifieds

[censored]

H3

Save £360 a year on fuel with these 8 simple driving tips

/property:
Title

Homes and Property in Wakefield from Wakefield Express

Description

Not defined

H3

Is your home making you ill?

/announcements:
Title

Wakefield Express Obituaries - Wakefield, West Yorkshire | Wakefield Express

Description

Wakefield Express notices and Death Notices for Wakefield West Yorkshire area . Explore Life Stories, Offer Condolences & Send Flowers.

/news:
Title

News - Wakefield Express

Description

Get the latest breaking news from the Wakefield Express - politics, transport, education, health, environment and more, updated daily.

H2

Headlines More Headlines >>

H3

Vehicle fire on M62 motorway in West Yorkshire

All the information about wakefieldexpress.co.uk was collected from publicly available sources

Similar domain names

wakefieldfamily.netwakefieldfamilymedicine.orgwakefieldfibreglassroofing.co.ukwakefieldestateshomevalues.comwakefieldescortsvip.comwakefieldequine.com



CAPTCHA ERROR
Recent Comments
Ronald Kurtz about trimbodymax.com
You took 89.95 and 84.95 at the same time from my back account that i didnt authorize and was apparently hacked. I...
Ester Joseph about repassists.com
Please refund my money back I never knew this am not interested
Jose Chavez about spoosk.com
Ive been charged for no reason this is fraud and want my money back!
CHANTREA BO about sitetaskreps.com
Good morning, Can you tell me what i have been charged for on 10/8/19 amount of $61..90 I believe this could be...
Leo Wickers IV about dotabon.com
Stop charging my account or police and better business bureau will be notified
tangi muzzo about attrdte.com
I need the money tht you took from my account.. I have no idea of what this site is all about.. Please return my...
Mthetheleli Peter about feemyd.com
This is a fraud I want my money back
motonobu matsubara about talentbrainstore.com
Please refund my 100yen and 10,000yen you took fraudulently as I never purchased or joined your site. Please cancel...
Selwyn Clarke about cartplay.com
Hi I sent an e-mail to you Thursday (nz) time and as yet I have had no response the number referred to is...
Nicolash Fernandes about ddos-guard.net
Knowing how reliable and secure DDoS protection service from ddos-guard.net, I have updated my plan with them and...
John about webtermdata.com
You have charged my credit card for $54.56 please add it back and cancel my subscription card ending 6485
DMCA.com Protection Status