Weirandsons.ie receives about 63519 visitors in one month. That could possibly earn $317.6 each month or $10.59 each day. Server of the website is located in Ireland. Weirandsons.ie main page was reached and loaded in 1.24 seconds. This is a good result. Try the services listed at the bottom of the page to search for available improvements.
Is weirandsons.ie legit? | |
Website Value | $5717 |
Alexa Rank | 599055 |
Monthly Visits | 63519 |
Daily Visits | 2118 |
Monthly Earnings | $317.6 |
Daily Earnings | $10.59 |
Country: Ireland
Metropolitan Area: Dublin
Postal Reference Code: D02
Latitude: 53.3338
Longitude: -6.2488
HTML Tag | Content | Informative? |
---|---|---|
Title: | Fine Diamonds, Jewellery & Luxury Watches | Weir & | Could be improved |
Description: | Weir & Sons, Grafton Street and Dundrum, Dublin - Official retailers of Patek Philippe and Rolex. Exclusive Black Friday Offers Available online. Free Worldwide Shipping on all orders. Same day in-store collection and next day delivery available. Retailers of fine diamonds, jewellery and watches | ![]() |
H1: | ROLEX AT WEIR & SONS | Is it informative enough? |
H2: | Engagement Rings | Is it informative enough? |
H3: | Daniel Wellington Oxford Watch - Special Price | Is it informative enough? |
Results will appear here |
|
Pingdom - Web transfer-speed test from Pingdom
Run diagnostic transfer-rate tests on each page or individual page components (JS, .img, and HTML code) with Pingdom for weirandsons.ie
Google’s Web Analytics Google provides many analytical tools for the web that will help you find out the number of visitors, their locations and activities when logging onto weirandsons.ie
Alexa - weirandsons.ie on Alexa Traffic Rank Data
Alexa provides a charting service that shows global position by audience, engagement, and time spent on weirandsons.ie
Majestic Backlinks - Lookup other webpages that have hyperlinks leading to weirandsons.ie.
Google Index - Which of the pages is Google.com indexing?
Find out which pages from weirandsons.ie have made it into Google.com’s listings. You can find out with the "site:" query.
Website on this IP by Bing - All sites on the same 52.213.70.249 IP
View a list of websites with an IP matching that of weirandsons.ie from Bing.com
/black-friday-event: | |
---|---|
Title |
Black Friday Deals at Weir & Sons Dublin |
Description |
Black Friday 2018 is nearly here! As every year we will have a very special offer for our clients. Bestselling gifts, watches and more! |
H2 |
Engagement Rings |
H3 |
30% Off Earrings |
/delivery: | |
---|---|
Title |
Delivery & In-store collection information |
Description |
Weir & Sons |
H1 |
Delivery Information |
H2 |
Engagement Rings |
H3 |
*DELAYED DELIVERIES |
/patek_philippe: | |
---|---|
Title |
Patek Philippe Watches |
Description |
Patek Phillipe and Weir & Sons prestigious partnership has been established since the 1930’s. Discover the collection and shop in-store. Patek Phillipe being Geneva’s last family-owned independent watch manufacture, both it and Weir & Sons share a rich heritage in family, quality craft and design. |
H2 |
Engagement Rings |
H3 |
Weirs through the years |
/sale/outlet.html: | |
---|---|
Title |
30% off Selected Jewellery & Watches - Weir & Sons |
Description |
30% off Emporio Armani, Hugo Boss and more - online exclusive sale and special offer jewellery and watches. Indulge in up to 30% off special price trinkets and gifts from our exclusive collection of exceptionally priced jewellery and watches. |
H1 |
The Outlet |
H2 |
Engagement Rings |
H3 |
Earrings |
/sale/outlet/watches.html: | |
---|---|
Title |
Sale Watches from €98 | 30% Off Boss & Armani | Weir & Sons |
Description |
Weir & Sons |
H1 |
Watches |
H2 |
Engagement Rings |
H3 |
at your service |
Similar domain names
weirandsonsbespoke.comweiranfshi.comweiranfushi.comweirandkestnerlawfirmsmyrna.comweirandfecht.netweirandcollc.com
You took 89.95 and 84.95 at the same time from my back account that i didnt authorize and was apparently hacked. I...