Wickedweasel.com receives about 530444 visitors in one month. That could possibly earn $2652.22 each month or $88.41 each day. Server of the website is located in the United States. Wickedweasel.com main page was reached and loaded in 0.64 seconds. This is a good result. Try the services listed at the bottom of the page to search for available improvements.
Is wickedweasel.com legit? | |
Website Value | $47740 |
Alexa Rank | 18970 |
Monthly Visits | 530444 |
Daily Visits | 17682 |
Monthly Earnings | $2652.22 |
Daily Earnings | $88.41 |
Country: United States
Metropolitan Area: San Antonio
Postal Reference Code: 78288
Latitude: 29.4247
Longitude: -98.4935
HTML Tag | Content | Informative? |
---|---|---|
Title: | Wicked Weasel - Turning Heads Since 1994 | Lingerie, Swimsuits, Dresses, Bikinis, | ![]() |
Description: | We know what you want. You want lingerie and bikinis that show off your best assets. Find the perfect can't say no outfit from our ranges | ![]() |
H2: | Is it informative enough? |
Results will appear here |
|
Pingdom - Web transfer-speed test from Pingdom
Run diagnostic transfer-rate tests on each page or individual page components (JS, .img, and HTML code) with Pingdom for wickedweasel.com
Google’s Web Analytics Google provides many analytical tools for the web that will help you find out the number of visitors, their locations and activities when logging onto wickedweasel.com
Alexa - wickedweasel.com on Alexa Traffic Rank Data
Alexa provides a charting service that shows global position by audience, engagement, and time spent on wickedweasel.com
Majestic Backlinks - Lookup other webpages that have hyperlinks leading to wickedweasel.com.
Google Index - Which of the pages is Google.com indexing?
Find out which pages from wickedweasel.com have made it into Google.com’s listings. You can find out with the "site:" query.
Website on this IP by Bing - All sites on the same 52.171.222.247 IP
View a list of websites with an IP matching that of wickedweasel.com from Bing.com
/en-us: | |
---|---|
Title |
Wicked Weasel - Turning Heads Since 1994 | Lingerie, Swimsuits, Dresses, Bikinis, Competition |
Description |
We know what you want. You want lingerie and bikinis that show off your best ets. Find the perfect can't say no outfit from our ranges today. [censored]
|
Similar domain names
wickedweasel.communitywickedweasel.companywickedweasel.digitalwickedweasel.cloudwickedweasel.clickwickedweaseal.com
You took 89.95 and 84.95 at the same time from my back account that i didnt authorize and was apparently hacked. I...