Wickedweasel.com Website Review


Make info private

Traffic and Value

Is wickedweasel.com legit?
Website Value $47740
Alexa Rank 18970
Monthly Visits 530444
Daily Visits 17682
Monthly Earnings $2652.22
Daily Earnings $88.41
Click Here for Full Review

Wickedweasel.com Server Location

Country: United States
Metropolitan Area: San Antonio
Postal Reference Code: 78288
Latitude: 29.4247
Longitude: -98.4935




Summarized Content

Sign up for news and updates Please enter valid email address Subscribe Copyright © 1998 - 2019 wicked weasel pty ltd abn 23 003 927 553. Please give our new site a rating Please tell us what you think


Wickedweasel Main Page Content

HTML Tag Content Informative?
Title: Wicked Weasel - Turning Heads Since 1994 | Lingerie, Swimsuits, Dresses, Bikinis,
Description: We know what you want. You want lingerie and bikinis that show off your best assets. Find the perfect can't say no outfit from our ranges
H2: Is it informative enough?

Other Helpful Websites and Services for Wickedweasel

Internal Pages

/en-us:
Title

Wicked Weasel - Turning Heads Since 1994 | Lingerie, Swimsuits, Dresses, Bikinis, Competition

Description

We know what you want. You want lingerie and bikinis that show off your best ets. Find the perfect can't say no outfit from our ranges today.

[censored]

All the information about wickedweasel.com was collected from publicly available sources

Similar domain names

wickedweasel.communitywickedweasel.companywickedweasel.digitalwickedweasel.cloudwickedweasel.clickwickedweaseal.com



CAPTCHA ERROR
Recent Comments
Ronald Kurtz about trimbodymax.com
You took 89.95 and 84.95 at the same time from my back account that i didnt authorize and was apparently hacked. I...
Ester Joseph about repassists.com
Please refund my money back I never knew this am not interested
Jose Chavez about spoosk.com
Ive been charged for no reason this is fraud and want my money back!
CHANTREA BO about sitetaskreps.com
Good morning, Can you tell me what i have been charged for on 10/8/19 amount of $61..90 I believe this could be...
Leo Wickers IV about dotabon.com
Stop charging my account or police and better business bureau will be notified
tangi muzzo about attrdte.com
I need the money tht you took from my account.. I have no idea of what this site is all about.. Please return my...
Mthetheleli Peter about feemyd.com
This is a fraud I want my money back
motonobu matsubara about talentbrainstore.com
Please refund my 100yen and 10,000yen you took fraudulently as I never purchased or joined your site. Please cancel...
Selwyn Clarke about cartplay.com
Hi I sent an e-mail to you Thursday (nz) time and as yet I have had no response the number referred to is...
Nicolash Fernandes about ddos-guard.net
Knowing how reliable and secure DDoS protection service from ddos-guard.net, I have updated my plan with them and...
John about webtermdata.com
You have charged my credit card for $54.56 please add it back and cancel my subscription card ending 6485
DMCA.com Protection Status