www.legacyacademyfranchisereviews.info Insights

Legacyacademyfranchisereviews website analysis


Make info private

Basic Information

Do you think that legacyacademyfranchisereviews.info is legit?


Website’s Current IP: 98.129.229.247. The server for Legacyacademyfranchisereviews.info's host is located in Lansing, United States.
Click Here for Full Review


legacyacademyfranchisereviews.info domain was purchased by Private on 2017-10-26 and 2018-10-26 is the date of registration expiration. The registrant is located in mount laurel, United States. Willing to contact legacyacademyfranchisereviews.info owner? Try reaching him with this email Private or call Provate.


More contact details:


Registrar
id 146
name GoDaddy.com, LLC
whois whois.godaddy.com
url http://registrar.godaddy.com
Registrant
name Private
address Private
city mount laurel
state New Jersey
zip Private
country United States
email Private
phone Provate
Administrative
name marc cornish
address 6000 commerce parkway
city mount laurel
state New Jersey
zip 08054
country United States
email [email protected]
phone +1.8889324629

legacyacademyfranchisereviews.info Traffic and Value

Promote Legacyacademyfranchisereviews on social media networks
Use social media to promote your Legacyacademyfranchisereviews website and embrace the visual to get more engagement. Customize the content of www.legacyacademyfranchisereviews.info for publishing in different categories.
Outreach
Drive more meetings with prospects and webmasters to motivate them for publishing a link to legacyacademyfranchisereviews.info. Create high-quality content to attract readers from other websites.
Directories
Boost traffic on your www.legacyacademyfranchisereviews.info by improving your presence on the Internet and Directories can help you get more visitors by making relevant submissions.
Competition research
Employ some form of competition research for www.legacyacademyfranchisereviews.info to know how they are attracting visitors. Know their traffic sources and find out any shortcoming in your business strategy.


www.legacyacademyfranchisereviews.info Server Location

Country: United States
Metropolitan Area: Lansing
Postal Reference Code: 48917
Latitude: 42.7348
Longitude: -84.6245


Other Helpful Websites and Services for Legacyacademyfranchisereviews.info



CAPTCHA ERROR
Recent Comments
Ronald Kurtz about trimbodymax.com
You took 89.95 and 84.95 at the same time from my back account that i didnt authorize and was apparently hacked. I...
Ester Joseph about repassists.com
Please refund my money back I never knew this am not interested
Jose Chavez about spoosk.com
Ive been charged for no reason this is fraud and want my money back!
CHANTREA BO about sitetaskreps.com
Good morning, Can you tell me what i have been charged for on 10/8/19 amount of $61..90 I believe this could be...
Leo Wickers IV about dotabon.com
Stop charging my account or police and better business bureau will be notified
tangi muzzo about attrdte.com
I need the money tht you took from my account.. I have no idea of what this site is all about.. Please return my...
Mthetheleli Peter about feemyd.com
This is a fraud I want my money back
motonobu matsubara about talentbrainstore.com
Please refund my 100yen and 10,000yen you took fraudulently as I never purchased or joined your site. Please cancel...
Selwyn Clarke about cartplay.com
Hi I sent an e-mail to you Thursday (nz) time and as yet I have had no response the number referred to is...
Nicolash Fernandes about ddos-guard.net
Knowing how reliable and secure DDoS protection service from ddos-guard.net, I have updated my plan with them and...
John about webtermdata.com
You have charged my credit card for $54.56 please add it back and cancel my subscription card ending 6485

Data on legacyacademyfranchisereviews.info is a bit old already

Would you like to update legacyacademyfranchisereviews.info in a quick mode?

Update

DMCA.com Protection Status