www.swissarmyknifedigitalmarketing.com Insights

Swissarmyknifedigitalmarketing website analysis


Make info private

Basic Information

Do you think that swissarmyknifedigitalmarketing.com is legit?


Website’s Current IP: 185.128.212.83. The server for Swissarmyknifedigitalmarketing.com's host is located in Russia.
Click Here for Full Review


swissarmyknifedigitalmarketing.com domain was purchased by Private on 2018-04-13 and 2019-04-13 is the date of registration expiration. The registrant is located in Chesterbrook, United States. Willing to contact swissarmyknifedigitalmarketing.com owner? Try reaching him with this email Private or call Provate.


More contact details:


Registrar
id 83
name 1&1 Internet AG
whois whois.schlund.info
url http://1and1.com
Registrant
name Private
company 1&1 Internet Inc
address Private
city Chesterbrook
state PA
zip Private
country United States
email Private
phone Provate
Administrative
name Oneandone Private Registration
company 1&1 Internet Inc
address 701 Lee Road Suite 300 ATTN
city Chesterbrook
state PA
zip 19087
country United States
email [email protected]
phone +1.8772064254

swissarmyknifedigitalmarketing.com Traffic and Value

Promote Swissarmyknifedigitalmarketing on social media networks
Promote about your Swissarmyknifedigitalmarketing website on different social media networks and try to provide accurate information about www.swissarmyknifedigitalmarketing.com. Share at the right platforms at the right time to derive more traffic.
Outreach
Reach beyond boundaries by meeting with prospects and encouraging other website owners to publish links on swissarmyknifedigitalmarketing.com. Provide useful content to attract a good number of readers.
Directories
Use web directories to publish information about www.swissarmyknifedigitalmarketing.com under relevant category topics but never forget to maintain the quality before making the submissions.
Competition research
Conduct a competitive assessment for www.swissarmyknifedigitalmarketing.com to deepen your understanding of the strengths of your competitors. Know their sources of traffic to improve your SEO performance.


www.swissarmyknifedigitalmarketing.com Server Location

Country: Russia
Metropolitan Area: Not defined
Postal Reference Code: Not defined
Latitude: 55.7386
Longitude: 37.6068


Other Helpful Websites and Services for Swissarmyknifedigitalmarketing.com



CAPTCHA ERROR
Recent Comments
Ronald Kurtz about trimbodymax.com
You took 89.95 and 84.95 at the same time from my back account that i didnt authorize and was apparently hacked. I...
Ester Joseph about repassists.com
Please refund my money back I never knew this am not interested
Jose Chavez about spoosk.com
Ive been charged for no reason this is fraud and want my money back!
CHANTREA BO about sitetaskreps.com
Good morning, Can you tell me what i have been charged for on 10/8/19 amount of $61..90 I believe this could be...
Leo Wickers IV about dotabon.com
Stop charging my account or police and better business bureau will be notified
tangi muzzo about attrdte.com
I need the money tht you took from my account.. I have no idea of what this site is all about.. Please return my...
Mthetheleli Peter about feemyd.com
This is a fraud I want my money back
motonobu matsubara about talentbrainstore.com
Please refund my 100yen and 10,000yen you took fraudulently as I never purchased or joined your site. Please cancel...
Selwyn Clarke about cartplay.com
Hi I sent an e-mail to you Thursday (nz) time and as yet I have had no response the number referred to is...
Nicolash Fernandes about ddos-guard.net
Knowing how reliable and secure DDoS protection service from ddos-guard.net, I have updated my plan with them and...
John about webtermdata.com
You have charged my credit card for $54.56 please add it back and cancel my subscription card ending 6485

Data on swissarmyknifedigitalmarketing.com is a bit old already

Would you like to update swissarmyknifedigitalmarketing.com in a quick mode?

Update

DMCA.com Protection Status